KEGG   Homo sapiens (human): 2529Help
Entry
2529              CDS       T01001                                 

Gene name
FUT7, FucT-VII
Definition
fucosyltransferase 7 (alpha (1,3) fucosyltransferase) (EC:2.4.1.-)
Orthology
K07635  
galactoside alpha-1,3-fucosyltransferase 7 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Other types of O-glycan biosynthesis
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:hsa00514]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:hsa00601]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.3
AA seq 342 aa AA seqDB search
MNNAGHGPTRRLRGLGVLAGVALLAALWLLWLLGSAPRGTPAPQPTITILVWHWPFTDQP
PELPSDTCTRYGIARCHLSANRSLLASADAVVFHHRELQTRRSHLPLAQRPRGQPWVWAS
MESPSHTHGLSHLRGIFNWVLSYRRDSDIFVPYGRLEPHWGPSPPLPAKSRVAAWVVSNF
QERQLRARLYRQLAPHLRVDVFGRANGRPLCASCLVPTVAQYRFYLSFENSQHRDYITEK
FWRNALVAGTVPVVLGPPRATYEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFA
WRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgctgggcacggccccacccggaggctgcgaggcttgggggtcctggccggg
gtggctctgctcgctgccctctggctcctgtggctgctggggtcagcccctcggggtacc
ccggcaccccagcccacgatcaccatccttgtctggcactggcccttcactgaccagccc
ccagagctgcccagcgacacctgcacccgctacggcatcgcccgctgccacctgagtgcc
aaccgaagcctgctggccagcgccgacgccgtggtcttccaccaccgcgagctgcagacc
cggcggtcccacctgcccctggcccagcggccgcgagggcagccctgggtgtgggcctcc
atggagtctcctagccacacccacggcctcagccacctccgaggcatcttcaactgggtg
ctgagctaccggcgcgactcggacatctttgtgccctatggccgcctggagccccactgg
gggccctcgccaccgctgccagccaagagcagggtggccgcctgggtggtcagcaacttc
caggagcggcagctgcgtgccaggctgtaccggcagctggcgcctcatctgcgggtggat
gtctttggccgtgccaatggacggccactgtgcgccagctgcctggtgcccaccgtggcc
cagtaccgcttctacctgtcctttgagaactctcagcaccgcgactacattacggagaaa
ttctggcgcaacgcactggtggctggcactgtgccagtggtgctggggcccccacgggcc
acctatgaggccttcgtgccggctgacgccttcgtgcatgtggatgactttggctcagcc
cgagagctggcggctttcctcactggcatgaatgagagccgataccaacgcttctttgcc
tggcgtgacaggctccgcgtgcgactgttcaccgactggcgggaacgtttctgtgccatc
tgtgaccgctacccacacctaccccgcagccaagtctatgaggaccttgagggttggttt
caggcctga

DBGET integrated database retrieval system