KEGG   Homo sapiens (human): 10690Help
Entry
10690             CDS       T01001                                 

Gene name
FUT9, Fuc-TIX
Definition
fucosyltransferase 9 (alpha (1,3) fucosyltransferase) (EC:2.4.1.152)
Orthology
K03663  
4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase [EC:2.4.1.152]
Organism
hsa  Homo sapiens (human)
Pathway
Other types of O-glycan biosynthesis
Glycosphingolipid biosynthesis - lacto and neolacto series
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:hsa00514]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:hsa00601]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:hsa00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q16
AA seq 359 aa AA seqDB search
MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDY
FNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNL
PQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVF
EVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKF
YLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAK
YLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaacatccaaaggaattcttcgcccatttttaattgtctgcattatcctgggc
tgtttcatggcatgtcttctcatttacatcaaacctaccaacagctggatcttcagtcca
atggaatcagccagctctgtgctgaaaatgaaaaacttcttttccaccaaaactgattat
tttaatgaaactactattctggtgtgggtgtggccatttgggcagacctttgaccttaca
tcctgccaagcaatgttcaacatccaaggatgccatctcacaacggaccgttcactgtac
aacaaatcccatgcagttctgatccatcaccgagacatcagttgggatctgacaaattta
cctcagcaagctaggccacccttccagaaatggatttggatgaatttggaatcaccaact
cacactccccaaaagagtggcattgagcacttgtttaacctgactctgacttaccgccgt
gattcagatatccaagtgccttatggcttcttgacggtaagcacaaatcccttcgtgttt
gaagtgccaagcaaagagaaattggtgtgctgggttgtgagtaactggaaccctgagcat
gccagagtcaagtattacaatgagctaagcaaaagcattgaaatccatacctacgggcaa
gcatttggagaatatgtcaatgataaaaatttgattcctaccatatctacttgtaaattt
tatctttcctttgaaaattcaatccacaaggattacatcacggaaaagctatacaatgct
tttctggctggctctgtacctgttgttctgggaccatctagggaaaactatgagaattat
attccagcagattcattcattcatgtggaagattataactctcccagtgagctagcaaag
tatctgaaggaagtcgacaaaaacaataagttataccttagttactttaactggaggaag
gatttcactgtaaatcttccacgattttgggaatcacatgcatgtttggcttgcgatcat
gtgaaaaggcatcaagaatataagtctgttggtaatttagagaaatggttttggaattaa

DBGET integrated database retrieval system