KEGG   Homo sapiens (human): 55568Help
Entry
55568             CDS       T01001                                 

Gene name
GALNT10, GALNACT10, PPGALNACT10, PPGANTASE10
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 10
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00512  Mucin type O-glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    55568 (GALNT10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     55568 (GALNT10)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  Mucin-type
   55568 (GALNT10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C Glyco_tranf_2_2 DUF5332
Motif
Other DBs
NCBI-GeneID: 55568
NCBI-ProteinID: NP_938080
OMIM: 608043
HGNC: 19873
Ensembl: ENSG00000164574
Vega: OTTHUMG00000130145
Pharos: Q86SR1(Tbio)
UniProt: Q86SR1
Structure
PDB: 

Jmol
Position
5q33.2
AA seq 603 aa AA seqDB search
MRRKEKRLLQAVALVLAALVLLPNVGLWALYRERQPDGTPGGSGAAVAPAAGQGSHSRQK
KTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDK
ISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEI
VLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHC
EANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIP
PELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRM
EDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDV
AVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALG
SPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHS
MKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKF
NRN
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggaaggagaagcggctcctgcaggcggtggcgctggtgctggcggccctggtc
ctcctgcccaacgtggggctttgggcgctgtaccgcgagcggcagcccgacggcacccct
gggggatcgggggcggcggtggcgccggcggcgggacagggctcacacagtcgacaaaag
aaaacgtttttcttgggagatgggcagaagctgaaggactggcatgacaaggaggccatc
cggagggacgctcagcgcgtaggaaatggagaacaaggaagaccttaccccatgaccgat
gctgagagagtggatcaggcataccgagaaaatggatttaacatctacgtcagtgataaa
atctccttgaatcgctctctcccagatatccggcacccaaactgcaacagcaagcgctac
ctggagacacttcccaacacaagcatcatcatccccttccacaacgagggctggtcctcc
ctcctccgcaccgtccacagtgtgctcaatcgctcgcctccagagctggtcgccgagatt
gtactggtcgacgacttcagtgatcgagagcacctgaagaagcctcttgaagactacatg
gcccttttccccagtgtgaggattcttcgaaccaagaaacgggaagggctgataaggacc
cgaatgctgggggcctcagtggcaactggggatgtcatcacattcttggattcacactgt
gaagccaatgtcaactggcttccccccttgcttgaccgcattgctcggaaccgcaagacc
attgtgtgcccgatgattgatgtaattgaccatgacgactttcggtacgagacacaggca
ggggatgccatgcggggagcctttgactgggagatgtactacaagcggatcccgatccct
ccagaactgcagaaagctgaccccagcgacccatttgagtctcccgtgatggccggtgga
ctgttcgccgtggatcggaagtggttctgggaactcggcgggtatgacccaggcttggag
atctggggaggggagcagtatgaaatctccttcaaggtgtggatgtgtgggggccgcatg
gaggacatcccctgctccagggtgggccatatctacaggaagtatgtgccctacaaggtc
ccggccggagtcagcctggcccggaaccttaagcgggtggccgaagtgtggatggatgag
tacgcagagtacatttaccagcgccggcctgaataccgccacctctccgctggggatgtc
gcagtccagaaaaagctccgcagctcccttaactgcaagagtttcaagtggtttatgacg
aagatagcctgggacctgcccaaattctacccacccgtggagcccccggctgcagcttgg
ggggagatccgaaatgtgggcacagggctgtgtgcagacacaaagcacggggccttgggc
tccccactaaggctagagggctgcgtccgaggccgtggggaggctgcctggaacaacatg
caggtattcaccttcacctggagagaggacatccggcctggagacccccagcacaccaag
aagttctgctttgatgccatttcccacaccagccctgtcacgctgtacgactgccacagc
atgaagggcaaccagctgtggaaataccgcaaagacaagaccctgtaccaccctgtcagt
ggcagctgcatggactgcagtgaaagtgaccataggatcttcatgaacacctgcaaccca
tcctctctcacccagcagtggctgtttgaacacaccaactcaacagtcttggaaaaattc
aataggaactga

DBGET integrated database retrieval system