KEGG   Homo sapiens (human): 63917Help
Entry
63917             CDS       T01001                                 

Gene name
GALNT11, GALNAC-T11, GALNACT11
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 11
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00512  Mucin type O-glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    63917 (GALNT11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     63917 (GALNT11)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  Mucin-type
   63917 (GALNT11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 63917
NCBI-ProteinID: NP_071370
OMIM: 615130
HGNC: 19875
Ensembl: ENSG00000178234
Vega: OTTHUMG00000157251
Pharos: Q8NCW6(Tbio)
UniProt: Q8NCW6 A0A090N7X6
Position
7q36.1
AA seq 608 aa AA seqDB search
MGSVTVRYFCYGCLFTSATWTVLLFVYFNFSEVTQPLKNVPVKGSGPHGPSPKKFYPRFT
RGPSRVLEPQFKANKIDDVIDSRVEDPEEGHLKFSSELGMIFNERDQELRDLGYQKHAFN
MLISDRLGYHRDVPDTRNAACKEKFYPPDLPAASVVICFYNEAFSALLRTVHSVIDRTPA
HLLHEIILVDDDSDFDDLKGELDEYVQKYLPGKIKVIRNTKREGLIRGRMIGAAHATGEV
LVFLDSHCEVNVMWLQPLLAAIREDRHTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHF
KWDLVPLSELGRAEGATAPIKSPTMAGGLFAMNRQYFHELGQYDSGMDIWGGENLEISFR
IWMCGGKLFIIPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKEQYFSLRPD
LKTKSYGNISERVELRKKLGCKSFKWYLDNVYPEMQISGSHAKPQQPIFVNRGPKRPKVL
QRGRLYHLQTNKCLVAQGRPSQKGGLVVLKACDYSDPNQIWIYNEEHELVLNSLLCLDMS
ETRSSDPPRLMKCHGSGGSQQWTFGKNNRLYQVSVGQCLRAVDPLGQKGSVAMAICDGSS
SQQWHLEG
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtgtcacagttcggtatttctgttatgggtgcctttttacatctgcgacctgg
acagttttgctttttgtttatttcaacttcagtgaagtgactcagccacttaagaatgtg
cccgtcaaggggtctgggccccacggaccatctccaaaaaaattctatccccgtttcact
cgaggcccaagtcgagtgctcgagccacagttcaaagcaaacaaaattgacgatgtgata
gacagtcgtgttgaagatccagaagaaggccacttgaaattctcttctgaattaggtatg
atttttaatgaacgcgatcaagagttgagagacttgggctatcagaaacatgcttttaat
atgcttatcagtgaccgcttgggctaccacagagatgtgccagacacaaggaatgcagca
tgtaaagaaaagttctacccacctgacctgccagctgctagtgttgttatctgtttctat
aatgaagcgttttctgccttgcttcggacagtgcacagtgtcatagaccgcacgccagca
cacctgcttcatgagatcatccttgtggatgatgatagtgactttgatgatttgaaagga
gaactagatgaatatgtccaaaaatacctccctggaaaaattaaagtcataagaaataca
aagcgtgaggggttgattcgagggagaatgattggcgcggcccacgcgacaggagaagtc
cttgtgttcctggacagccactgtgaagtgaatgtgatgtggctgcagcccttgctggcc
gccatccgtgaggaccggcacaccgtggtgtgcccagtgattgacatcatcagcgccgac
acgctggcctacagctcgtcccctgtcgtccgcggagggttcaactggggactgcacttc
aaatgggatcttgtccccctttctgagctaggacgagcggagggagccactgcaccaata
aagtcaccaacaatggctggaggtttgtttgccatgaacagacagtatttccatgaactt
ggacagtatgatagtggcatggatatctggggaggagaaaatttggaaatatcatttcgg
atctggatgtgtggcggtaagctcttcatcatcccttgctctagagtaggacacattttc
cgaaaaaggcgaccatatggatctcccgaaggccaggacaccatgacacacaactctttg
cggctggcacatgtctggttggatgaatacaaggagcagtatttttccttaagacctgac
ctgaagacgaaaagctatggcaatatcagtgagcgtgtggaactgagaaagaagttgggc
tgtaaatcatttaaatggtatttggataatgtatacccagagatgcagatatctgggtcc
cacgccaaaccccaacaacccatttttgtcaatagagggccaaaacgacccaaagtcctt
caacgtggaaggctctatcacctccagaccaacaaatgcctggtggcccagggccgccca
agtcagaagggaggtctcgtggtgcttaaggcctgtgactacagtgacccaaatcagatc
tggatctataatgaagagcatgaattggttttaaatagtctcctttgtctagatatgtca
gagactcgctcatcagacccgccacggctcatgaaatgccacgggtcaggaggatcccag
cagtggacctttgggaaaaacaatcggctataccaggtgtcggttggacagtgcctgaga
gcagtggatcccctgggtcagaagggctctgtcgccatggcgatctgcgatggctcctct
tcacagcagtggcatttggaaggttaa

DBGET integrated database retrieval system