KEGG   Homo sapiens (human): 11227Help
Entry
11227             CDS       T01001                                 

Gene name
GALNT5, GALNAC-T5, GALNACT5
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 5
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00512  Mucin type O-glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    11227 (GALNT5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     11227 (GALNT5)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  Mucin-type
   11227 (GALNT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 11227
NCBI-ProteinID: NP_055383
OMIM: 615129
HGNC: 4127
Ensembl: ENSG00000136542
Vega: OTTHUMG00000131965
Pharos: Q7Z7M9(Tbio)
UniProt: Q7Z7M9
Position
2q24.1
AA seq 940 aa AA seqDB search
MNRIRKFFRGSGRVLAFIFVASVIWLLFDMAALRLSFSEINTRVIKEDIVRRERIGFRVQ
PDQGKIFYSSIKEMKPPLRGHGKGAWGKENVRKTEESVLKVEVDLDQTQRERKMQNALGR
GKVVPLWHPAHLQTLPVTPNKQKTDGRGTKPEASSHQGTPKQTTAQGAPKTSFIAAKGTQ
VVKISVHMGRVSLKQEPRKSHSPSSDTSKLAAERDLNVTISLSTDRPKQRSQAVANERAH
PASTAVPKSGEAMALNKTKTQSKEVNANKHKANTSLPFPKFTVNSNRLRKQSINETPLGS
LSKDDGARGAHGKKLNFSESHLVIITKEEEQKADPKEVSNSKTKTIFPKVLGKSQSKHIS
RNRSEMSSSSLAPHRVPLSQTNHALTGGLEPAKINITAKAPSTEYNQSHIKALLPEDSGT
HQVLRIDVTLSPRDPKAPGQFGRPVVVPHGKEKEAERRWKEGNFNVYLSDLIPVDRAIED
TRPAGCAEQLVHNNLPTTSVIMCFVDEVWSTLLRSVHSVINRSPPHLIKEILLVDDFSTK
DYLKDNLDKYMSQFPKVRILRLKERHGLIRARLAGAQNATGDVLTFLDSHVECNVGWLEP
LLERVYLSRKKVACPVIEVINDKDMSYMTVDNFQRGIFVWPMNFGWRTIPPDVIAKNRIK
ETDTIRCPVMAGGLFSIDKSYFFELGTYDPGLDVWGGENMELSFKVWMCGGEIEIIPCSR
VGHIFRNDNPYSFPKDRMKTVERNLVRVAEVWLDEYKELFYGHGDHLIDQGLDVGNLTQQ
RELRKKLKCKSFKWYLENVFPDLRAPIVRASGVLINVALGKCISIENTTVILEDCDGSKE
LQQFNYTWLRLIKCGEWCIAPIPDKGAVRLHPCDNRNKGLKWLHKSTSVFHPELVNHIVF
ENNQQLLCLEGNFSQKILKVAACDPVKPYQKWKFEKYYEA
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggatccgaaagtttttccgaggaagtgggcgagtcttggcatttatctttgta
gcttctgtcatctggctcctctttgacatggcagctctccgcctctcattcagtgagatc
aacactcgggtcatcaaggaagacattgtgaggagggagcggataggattcagagttcag
ccagaccaaggaaaaattttttacagcagcataaaagagatgaaacctcccctaagggga
catgggaaaggggcatggggcaaagagaatgttagaaaaactgaggagagtgtgctcaag
gttgaggtggacttggaccaaacccagagggaaagaaaaatgcagaatgccctgggaagg
ggcaaggttgtgccgttgtggcatcctgcacatctgcagaccctccctgtgactcctaac
aagcagaagacagacgggagaggcaccaaacctgaagcctcctctcaccaggggacacca
aagcaaacgacagctcagggggctccaaagacctcattcatagcagcaaaaggaactcag
gtagtcaaaatatcagtacacatgggacgtgtcagtttaaaacaggagccccggaagagt
catagtcccagcagtgacacatcaaaactagcagctgaaagggacttgaatgtgaccatc
agtcttagtactgatagaccaaagcagcgatcacaggcagtagcaaacgagagggcacac
cctgccagcacagcagtgccgaagtctggggaagccatggccttaaacaaaactaagact
cagagcaaagaagtcaatgcaaataaacacaaagccaatacgagtcttccttttcctaag
ttcactgtcaattcaaatcgcttaaggaagcaatctattaatgagacacctttgggaagt
ttgtcaaaggatgatggagctagaggggctcatgggaagaaactcaatttctctgaaagc
catcttgtgattataaccaaagaggaagagcaaaaggcagaccccaaagaggtctctaat
tctaaaaccaaaacaatatttcctaaagtattgggtaaaagccaaagtaaacacatttcc
aggaatagaagtgagatgtcttcctcttcacttgctccacatagagtgccactgtcccaa
actaaccatgctttaactggagggctagagccagcaaaaatcaacataactgccaaagcc
ccctctacagaatacaaccagagtcatataaaagcccttttacctgaagacagtggaacg
caccaggtgttaagaattgatgtgacactttctccaagggaccccaaagctccagggcag
tttgggcgtcctgtagttgtcccccatggaaaggagaaggaggcagaaagaagatggaaa
gaaggaaacttcaatgtctaccttagcgatttgatcccagtggatagagccattgaagac
accagacctgctggatgtgcagagcagctagttcacaataacctcccaaccaccagtgtc
atcatgtgctttgtggatgaagtgtggtccactctcctgagatctgttcacagtgtcatc
aatcgctctcctccacacctcatcaaggagattctgctggtagatgacttcagcaccaaa
gactatctaaaagataatttggataaatacatgtcccagtttccaaaagttcggattctt
cgcctcaaagagagacatggcttaataagggccaggctggcaggagcacagaatgcaaca
ggtgatgtgttgacatttttagattctcatgtggaatgtaacgttggttggttggaacct
cttctggaaagagtttatttaagtagaaagaaagtggcctgtccagtaatcgaagtcatc
aatgataaggatatgagttacatgacagtggataactttcaaagaggcatctttgtgtgg
cccatgaactttggttggagaacaattcctccagatgtcattgcaaaaaacagaattaaa
gaaactgatacaataaggtgccctgtcatggctggtggattgttttctattgacaaaagt
tacttttttgaacttggaacatacgaccctggccttgatgtttggggtggggaaaatatg
gagctctcattcaaggtgtggatgtgtggtggtgaaattgagatcattccctgctcccga
gtgggccatatattcagaaatgacaatccatattccttccccaaagaccggatgaagaca
gtggagcggaacttggtgcgggttgccgaggtctggctggatgagtataaggagctgttc
tatggccacggagaccacctcatcgaccaagggctagatgttggcaacctcacccagcaa
agggagctgcgaaagaaactgaagtgcaaaagtttcaaatggtacttggagaatgtcttt
cctgacttaagggctcccattgtgagagctagtggtgtgcttattaatgtggctttgggt
aaatgcatttccattgaaaacactacagtcattctggaagactgcgatgggagcaaagag
cttcaacaatttaattacacctggttaagacttattaaatgtggagaatggtgtatagcc
cccatccctgataaaggagccgtaaggctgcacccttgtgataacagaaacaaagggcta
aaatggctgcataaatcaacatcagtctttcatccagaactggtgaatcacattgttttt
gaaaacaatcagcaattattatgcttggaaggaaatttttctcaaaagatcctgaaagta
gctgcctgtgacccagtgaagccatatcaaaagtggaaatttgaaaaatattatgaagcc
tga

DBGET integrated database retrieval system