KEGG   Homo sapiens (human): 23193Help
Entry
23193             CDS       T01001                                 

Gene name
GANAB, G2AN, GLUII
Definition
glucosidase, alpha; neutral AB (EC:3.2.1.84)
Orthology
K05546  
alpha 1,3-glucosidase [EC:3.2.1.84]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.3
AA seq 852 aa AA seqDB search
MAAVAAVAARRRRLSVSGRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARG
LLEFEHQRAPRVSFSDKVNLTLGSIWDKIKNLFSRQGSKDPAEGDGAQPEETPRDGDKPE
ETQGKAEKDEPGAWEETFKTHSDSKPYGPMSVGLDFSLPGMEHVYGIPEHADNLRLKVTE
GGEPYRLYNLDVFQYELYNPMALYGSVPVLLAHNPHRDLGIFWLNAAETWVDISSNTAGK
TLFGKMMDYLQGSGETPQTDVRWMSETGIIDVFLLLGPSISDVFRQYASLTGTQALPPLF
SLGYHQSRWNYRDEADVLEVDQGFDDHNLPCDVIWLDIEHADGKRYFTWDPSRFPQPRTM
LERLASKRRKLVAIVDPHIKVDSGYRVHEELRNLGLYVKTRDGSDYEGWCWPGSAGYPDF
TNPTMRAWWANMFSYDNYEGSAPNLFVWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVH
NIYGLYVHMATADGLRQRSGGMERPFVLARAFFAGSQRFGAVWTGDNTAEWDHLKISIPM
CLSLGLVGLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQ
HNDIIRDALGQRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDVTTFNIDDQYLLGDAL
LVHPVSDSGAHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPR
WMRVRRSSECMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNTL
VSSSADPEGHFETPIWIERVVIIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPG
INVASDWSIHLR
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtagcggcagtggcggcgcgtaggaggcggctttctgtctctggtcgtgat
gagaacagtgtggagttaaccatggctgagggaccctacaagatcatcttgacagcacgg
ccattccgccttgacctactagaggaccgaagtcttttgcttagtgtcaatgcccgagga
ctcttggagtttgagcatcagagggcccctagggtctctttctcggataaggttaatctc
acgcttggtagcatatgggataagatcaagaaccttttctctaggcaaggatcaaaagac
ccagctgagggcgatggggcccagcctgaggaaacacccagggatggcgacaagccagag
gagactcaggggaaggcagagaaagatgagccaggagcctgggaggagacattcaaaact
cactctgacagcaagccgtatggccccatgtctgtgggtttggacttctctctgccaggc
atggagcatgtctatgggatccctgagcatgcagacaacctgaggctgaaggtcactgag
ggtggggagccatatcgcctctacaatttggatgtgttccagtatgagctgtacaaccca
atggccttgtatgggtctgtgcctgtgctcctggcacacaaccctcatcgcgacttgggc
atcttctggctcaatgctgcagagacctgggttgatatatcttccaacactgccgggaag
accctgtttgggaagatgatggactacctgcagggctctggggagaccccacagacagat
gttcgctggatgtcagagactggcatcattgacgtcttcctgctgctggggccctccatc
tctgatgttttccggcaatatgctagtctcacaggaacccaggcgttgcccccactcttc
tccctcggctaccaccagagccgttggaactaccgggacgaggctgatgtgctggaagtg
gatcagggctttgatgatcacaacctgccctgtgatgtcatctggctagacattgaacat
gctgatggcaagcggtatttcacctgggaccccagtcgcttccctcagccccgcaccatg
cttgagcgcttggcttctaagaggcggaagctggtggccatcgtagacccccacatcaag
gtggactccggctaccgagttcacgaggagctgcggaacctggggctgtatgttaaaacc
cgggatggctctgactatgagggctggtgctggccaggctcagctggttaccctgacttc
actaatcccacgatgagggcctggtgggctaacatgttcagctatgacaattatgagggc
tcagctcccaacctctttgtctggaatgacatgaacgaaccatctgtgttcaatggtcct
gaggtcaccatgctcaaggatgcccagcattatgggggctgggagcaccgggatgtgcat
aacatctatggcctttatgtgcacatggcgactgctgatgggctgagacagcgctctggg
ggcatggaacgcccctttgtcctggccagggccttcttcgctggctcccagcgctttgga
gccgtgtggacaggggacaacactgccgagtgggaccatttgaagatctctattcctatg
tgtctcagcttggggctggtgggactttccttctgtggggcggatgtgggtggcttcttc
aaaaacccagagccagagctgcttgtgcgctggtaccagatgggtgcttaccagccattc
ttccgggcacatgcccacttggacactgggcgacgagagccatggctgttaccatctcag
cacaatgatataatccgagatgccttgggccagcgatattctttgctgcccttctggtac
accctcttatatcaggcccatcgggaaggcattcctgtcatgaggcccctgtgggtgcag
taccctcaggatgtgactaccttcaatatagatgatcagtacttgcttggggatgcgttg
ctggttcaccctgtatcagactctggagcccatggtgtccaggtctatctgcctggccaa
ggggaggtgtggtatgacattcaaagctaccagaagcatcatggtccccagaccctgtac
ctgcctgtaactctaagcagtatccctgtgttccagcgtggagggacaatcgtgcctcga
tggatgcgagtgcggcggtcttcagaatgtatgaaggatgaccccatcactctctttgtt
gcacttagccctcagggtacagctcaaggagagctctttctggatgatgggcacacgttc
aactatcagactcgccaagagttcctgctgcgtcgattctcattctctggcaacaccctt
gtctccagctcagcagaccctgaaggacactttgagacaccaatctggattgagcgggtg
gtgataataggggctggaaagccagcagctgtggtactccagacaaaaggatctccagaa
agccgcctgtccttccagcatgaccctgagacctctgtgttggtcctgcgcaagcctggc
atcaatgtggcatctgattggagtattcacctgcgataa

DBGET integrated database retrieval system