KEGG   Homo sapiens (human): 23193Help
Entry
23193             CDS       T01001                                 

Gene name
GANAB, G2AN, GIIA, GLUII, PKD3
Definition
(RefSeq) glucosidase II alpha subunit (EC:3.2.1.84)
  KO
K05546  
alpha 1,3-glucosidase [EC:3.2.1.84]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    23193 (GANAB)
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    23193 (GANAB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.84  glucan 1,3-alpha-glucosidase
     23193 (GANAB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.3
AA seq 944 aa AA seqDB search
MAAVAAVAARRRRSWASLVLAFLGVCLGITLAVDRSNFKTCEESSFCKRQRSIRPGLSPY
RALLDSLQLGPDSLTVHLIHEVTKVLLVLELQGLQKNMTRFRIDELEPRRPRYRVPDVLV
ADPPIARLSVSGRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEH
QRAPRVSQGSKDPAEGDGAQPEETPRDGDKPEETQGKAEKDEPGAWEETFKTHSDSKPYG
PMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPYRLYNLDVFQYELYNPMALYGSVP
VLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGKMMDYLQGSGETPQTDVRWMSETG
IIDVFLLLGPSISDVFRQYASLTGTQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHN
LPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASKRRKLVAIVDPHIKVDSGYRVH
EELRNLGLYVKTRDGSDYEGWCWPGSAGYPDFTNPTMRAWWANMFSYDNYEGSAPNLFVW
NDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGLYVHMATADGLRQRSGGMERPFVL
ARAFFAGSQRFGAVWTGDNTAEWDHLKISIPMCLSLGLVGLSFCGADVGGFFKNPEPELL
VRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQAHR
EGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQ
SYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSECMKDDPITLFVALSPQGTA
QGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKP
AAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHLR
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtagcggcagtggcggcgcgtaggaggcggtcttgggcgtctttggtactg
gcttttttaggggtctgcctggggattacccttgctgtggatagaagcaactttaagacc
tgtgaagagagttctttctgcaagcgacagagaagcatacggccaggcctctctccatac
cgagccttgctggactctctacagcttggtcctgattccctcacggtccatctgatccat
gaggtcaccaaggtgttgctggtgctagagcttcaggggcttcaaaagaacatgactcgg
ttcaggattgatgagctggagcctcggcgaccccgataccgtgtaccagatgttttggtg
gctgatccaccaatagcccggctttctgtctctggtcgtgatgagaacagtgtggagtta
accatggctgagggaccctacaagatcatcttgacagcacggccattccgccttgaccta
ctagaggaccgaagtcttttgcttagtgtcaatgcccgaggactcttggagtttgagcat
cagagggcccctagggtctcgcaaggatcaaaagacccagctgagggcgatggggcccag
cctgaggaaacacccagggatggcgacaagccagaggagactcaggggaaggcagagaaa
gatgagccaggagcctgggaggagacattcaaaactcactctgacagcaagccgtatggc
cccatgtctgtgggtttggacttctctctgccaggcatggagcatgtctatgggatccct
gagcatgcagacaacctgaggctgaaggtcactgagggtggggagccatatcgcctctac
aatttggatgtgttccagtatgagctgtacaacccaatggccttgtatgggtctgtgcct
gtgctcctggcacacaaccctcatcgcgacttgggcatcttctggctcaatgctgcagag
acctgggttgatatatcttccaacactgccgggaagaccctgtttgggaagatgatggac
tacctgcagggctctggggagaccccacagacagatgttcgctggatgtcagagactggc
atcattgacgtcttcctgctgctggggccctccatctctgatgttttccggcaatatgct
agtctcacaggaacccaggcgttgcccccactcttctccctcggctaccaccagagccgt
tggaactaccgggacgaggctgatgtgctggaagtggatcagggctttgatgatcacaac
ctgccctgtgatgtcatctggctagacattgaacatgctgatggcaagcggtatttcacc
tgggaccccagtcgcttccctcagccccgcaccatgcttgagcgcttggcttctaagagg
cggaagctggtggccatcgtagacccccacatcaaggtggactccggctaccgagttcac
gaggagctgcggaacctggggctgtatgttaaaacccgggatggctctgactatgagggc
tggtgctggccaggctcagctggttaccctgacttcactaatcccacgatgagggcctgg
tgggctaacatgttcagctatgacaattatgagggctcagctcccaacctctttgtctgg
aatgacatgaacgaaccatctgtgttcaatggtcctgaggtcaccatgctcaaggatgcc
cagcattatgggggctgggagcaccgggatgtgcataacatctatggcctttatgtgcac
atggcgactgctgatgggctgagacagcgctctgggggcatggaacgcccctttgtcctg
gccagggccttcttcgctggctcccagcgctttggagccgtgtggacaggggacaacact
gccgagtgggaccatttgaagatctctattcctatgtgtctcagcttggggctggtggga
ctttccttctgtggggcggatgtgggtggcttcttcaaaaacccagagccagagctgctt
gtgcgctggtaccagatgggtgcttaccagccattcttccgggcacatgcccacttggac
actgggcgacgagagccatggctgttaccatctcagcacaatgatataatccgagatgcc
ttgggccagcgatattctttgctgcccttctggtacaccctcttatatcaggcccatcgg
gaaggcattcctgtcatgaggcccctgtgggtgcagtaccctcaggatgtgactaccttc
aatatagatgatcagtacttgcttggggatgcgttgctggttcaccctgtatcagactct
ggagcccatggtgtccaggtctatctgcctggccaaggggaggtgtggtatgacattcaa
agctaccagaagcatcatggtccccagaccctgtacctgcctgtaactctaagcagtatc
cctgtgttccagcgtggagggacaatcgtgcctcgatggatgcgagtgcggcggtcttca
gaatgtatgaaggatgaccccatcactctctttgttgcacttagccctcagggtacagct
caaggagagctctttctggatgatgggcacacgttcaactatcagactcgccaagagttc
ctgctgcgtcgattctcattctctggcaacacccttgtctccagctcagcagaccctgaa
ggacactttgagacaccaatctggattgagcgggtggtgataataggggctggaaagcca
gcagctgtggtactccagacaaaaggatctccagaaagccgcctgtccttccagcatgac
cctgagacctctgtgttggtcctgcgcaagcctggcatcaatgtggcatctgattggagt
attcacctgcgataa

DBGET integrated database retrieval system