KEGG   Homo sapiens (human): 2632Help
Entry
2632              CDS       T01001                                 

Gene name
GBE1, APBD, GBE, GSD4
Definition
(RefSeq) 1,4-alpha-glucan branching enzyme 1
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Disease
H00069  
Glycogen storage diseases (GSD)
H01760  
Hepatic glycogen storage disease
H01762  
Muscle glycogen storage disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    2632 (GBE1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     2632 (GBE1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2632 (GBE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q04446(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3p12.2
AA seq 702 aa AA seqDB search
MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIG
ENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYG
KWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDP
EHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAI
MEHAYYASFGYQITSFFAASSRYGTPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGL
NMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVT
SMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPAL
CSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESH
DQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMG
NEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAP
QAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGH
QRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgatgactcccgcggctcggcccgaggactacgaggcggcgctcaatgcc
gccctggctgacgtgcccgaactggccagactcctggagatcgacccgtacttgaagccc
tacgccgtggacttccagcgcaggtataagcagtttagccaaattttgaagaacattgga
gaaaatgaaggtggtattgataagttttccagaggctatgaatcatttggcgtccacaga
tgtgctgatggtggtttatactgcaaagaatgggccccgggagcagaaggagtttttctt
actggagattttaatggttggaatccattttcgtacccatacaaaaaactggattatgga
aaatgggagctgtatatcccaccaaagcagaataaatctgtactcgtgcctcatggatcc
aaattaaaggtagttattactagtaaaagcggagagatcttgtatcgtatttcaccgtgg
gcaaagtatgtggttcgtgaaggtgataatgtgaattatgattggatacactgggatcca
gaacactcatatgagtttaagcattccagaccaaagaagccacggagtctaagaatttat
gaatctcatgtgggaatttcttcccatgaaggaaaagtagcttcttataaacattttaca
tgcaatgtactaccaagaatcaaaggccttggatacaactgcattcagttgatggcaatc
atggagcatgcttactatgccagctttggttaccaaatcacaagcttctttgcagcttcc
agccgttatggaacacctgaagagctacaagaactggtagacacagctcattccatgggt
atcatagtcctcttagatgtggtacacagccatgcttcaaaaaattcagcagatggattg
aatatgtttgatgggacagattcctgttattttcattctggacctagagggactcatgat
ctttgggatagcagattgtttgcctactccagctgggaagttttaagattccttctgtca
aacataagatggtggttggaagaatatcgctttgatggatttcgttttgatggtgttacg
tccatgctttatcatcaccatggagtgggtcaaggtttctcaggtgattacagtgaatat
ttcggactacaagtagatgaagatgccttgacttacctcatgttggcaaatcatttggtt
cacacgctgtgtcccgattctataacaatagctgaggatgtatcaggaatgccagctctg
tgctctccaatttcccagggagggggtggttttgactatcgactagccatggcaattcca
gataagtggattcagctacttaaagagtttaaagatgaagactggaacatgggcgatata
gtatacacgctcacaaacaggcgctaccttgaaaagtgcattgcttatgcagagagccat
gatcaggcattggttggggataagtcgctggcattttggttgatggatgccgaaatgtat
acaaacatgagtgtcctgactccttttactccagttattgatcgtggaatacagcttcat
aaaatgattcgactcattacgcatgggcttggtggagaaggctatctcaatttcatgggt
aatgaatttgggcatcctgaatggttagacttcccaagaaaaggaaataatgagagttac
cattatgccaggcggcagtttcatttaactgacgacgaccttcttcgctacaagttccta
aataattttgacagggatatgaatagattggaagaaagatatggttggcttgcagctcca
caggcctacgtgagtgaaaaacatgaaggcaataagatcattgcttttgaaagagcaggt
cttcttttcattttcaacttccatccaagcaagagctacactgactaccgagttggaaca
gcattgccagggaaattcaaaattgtgctagattcagatgcagcggaatatggagggcat
cagagactggaccacagcactgactttttttctgaggcttttgaacataatgggcgtccc
tattctcttttggtgtacattccaagcagagtggccctcatccttcagaatgtggatctg
ccgaattga

DBGET integrated database retrieval system