KEGG   Homo sapiens (human): 2632Help
Entry
2632              CDS       T01001                                 

Gene name
GBE1, APBD, GBE, GSD4
Definition
glucan (1,4-alpha-), branching enzyme 1 (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Disease
H00069  
Glycogen storage diseases (GSD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    2632 (GBE1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     2632 (GBE1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2632 (GBE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p12.3
AA seq 702 aa AA seqDB search
MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIG
ENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYG
KWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDP
EHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAI
MEHAYYASFGYQITSFFAASSRYGTPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGL
NMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVT
SMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPAL
CSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESH
DQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMG
NEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAP
QAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGH
QRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgatgactcccgcggctcggcccgaggactacgaggcggcgctcaatgcc
gccctggctgacgtgcccgaactggccagactcctggagatcgacccgtacttgaagccc
tacgccgtggacttccagcgcaggtataagcagtttagccaaattttgaagaacattgga
gaaaatgaaggtggtattgataagttttccagaggctatgaatcatttggcgtccacaga
tgtgctgatggtggtttatactgcaaagaatgggccccgggagcagaaggagtttttctt
actggagattttaatggttggaatccattttcgtacccatacaaaaaactggattatgga
aaatgggagctgtatatcccaccaaagcagaataaatctgtactcgtgcctcatggatcc
aaattaaaggtagttattactagtaaaagcggagagatcttgtatcgtatttcaccgtgg
gcaaagtatgtggttcgtgaaggtgataatgtgaattatgattggatacactgggatcca
gaacactcatatgagtttaagcattccagaccaaagaagccacggagtctaagaatttat
gaatctcatgtgggaatttcttcccatgaaggaaaagtagcttcttataaacattttaca
tgcaatgtactaccaagaatcaaaggccttggatacaactgcattcagttgatggcaatc
atggagcatgcttactatgccagctttggttaccaaatcacaagcttctttgcagcttcc
agccgttatggaacacctgaagagctacaagaactggtagacacagctcattccatgggt
atcatagtcctcttagatgtggtacacagccatgcttcaaaaaattcagcagatggattg
aatatgtttgatgggacagattcctgttattttcattctggacctagagggactcatgat
ctttgggatagcagattgtttgcctactccagctgggaagttttaagattccttctgtca
aacataagatggtggttggaagaatatcgctttgatggatttcgttttgatggtgttacg
tccatgctttatcatcaccatggagtgggtcaaggtttctcaggtgattacagtgaatat
ttcggactacaagtagatgaagatgccttgacttacctcatgttggcaaatcatttggtt
cacacgctgtgtcccgattctataacaatagctgaggatgtatcaggaatgccagctctg
tgctctccaatttcccagggagggggtggttttgactatcgactagccatggcaattcca
gataagtggattcagctacttaaagagtttaaagatgaagactggaacatgggcgatata
gtatacacgctcacaaacaggcgctaccttgaaaagtgcattgcttatgcagagagccat
gatcaggcattggttggggataagtcgctggcattttggttgatggatgccgaaatgtat
acaaacatgagtgtcctgactccttttactccagttattgatcgtggaatacagcttcat
aaaatgattcgactcattacgcatgggcttggtggagaaggctatctcaatttcatgggt
aatgaatttgggcatcctgaatggttagacttcccaagaaaaggaaataatgagagttac
cattatgccaggcggcagtttcatttaactgacgacgaccttcttcgctacaagttccta
aataattttgacagggatatgaatagattggaagaaagatatggttggcttgcagctcca
caggcctacgtgagtgaaaaacatgaaggcaataagatcattgcttttgaaagagcaggt
cttcttttcattttcaacttccatccaagcaagagctacactgactaccgagttggaaca
gcattgccagggaaattcaaaattgtgctagattcagatgcagcggaatatggagggcat
cagagactggaccacagcactgactttttttctgaggcttttgaacataatgggcgtccc
tattctcttttggtgtacattccaagcagagtggccctcatccttcagaatgtggatctg
ccgaattga

DBGET integrated database retrieval system