KEGG   Homo sapiens (human): 26301Help
Entry
26301             CDS       T01001                                 

Gene name
GBGT1, A3GALNT, FS, UNQ2513
Definition
globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 (EC:2.4.1.88)
Orthology
K00722  
globoside alpha-N-acetylgalactosaminyltransferase [EC:2.4.1.88]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    26301 (GBGT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.88  globoside alpha-N-acetylgalactosaminyltransferase
     26301 (GBGT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Forssman antigen
   26301 (GBGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.13-q34.3
AA seq 294 aa AA seqDB search
MHRRRLALGLGFCLLAGTSLSVLWVYLENWLPVSYVPYYLPCPEIFNMKLHYKREKPLQP
VVWSQYPQPKLLEHRPTQLLTLTPWLAPIVSEGTFNPELLQHIYQPLNLTIGVTVFAVGN
PSWSQPRSSSCVGTGCTTTSSLTTLQPFPGSRWVPTGFSAPSPSRVTPTGRRHPCAGWRP
SASTLLRGLTGRWTTSSALMWTWCFGTRGALRPWETWWLPFTQATTPFPASSSPMSAGVF
PLPLWQTAKGTSIMVGQSSGGRWPGYMSLLGAATWPSWRTRPMASWLPGGRKAT
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgccggagactggccctgggtctggggttctgcctgttggcgggcacaagcctc
agtgtcctgtgggtgtatcttgagaactggctgccagtctcctatgtcccctattatctc
ccctgcccagagatcttcaacatgaagctgcactacaagagggagaagccactccagccc
gtggtatggtcacagtaccctcagcccaagctgctggagcacaggcccacacagctgctg
acactcacaccctggttggcgcccatcgtctccgagggaaccttcaacccagagcttctg
cagcacatctaccagccactgaacctgaccattggggtcacggtgtttgccgtggggaat
ccttcctggagtcagccgaggagttcttcatgcgtgggtaccgggtgcactactacatct
tcactgacaaccctgcagccgttcccggggtcccgctgggtccccaccggcttctcagct
ccatccccatccagggtcactcccactgggaggagacatccatgcgccggatggagacca
tcagccagcacattgctaagagggctcaccgggaggtggactacctcttctgccttgatg
tggacatggtgtttcggaacccgtggggccctgagaccttgggagacctggtggctgcca
ttcacccaagctactacgccgttccccgccagcagttcccctatgagcgcaggcgtgttt
ccactgcctttgtggcagacagcgaaggggacttctattatggtggggcagtcttcgggg
ggcaggtggccagggtatatgagtttactaggggctgccacatggccatcctggcggaca
aggccaatggcatcatggctgcctggcgggaggaaagccacctga

DBGET integrated database retrieval system