KEGG   Homo sapiens (human): 2650Help
Entry
2650              CDS       T01001                                 

Gene name
GCNT1, C2GNT, C2GNT-L, C2GNT1, G6NT, NACGT2, NAGCT2
Definition
glucosaminyl (N-acetyl) transferase 1, core 2 (EC:2.4.1.102)
Orthology
K00727  
beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase [EC:2.4.1.102]
Organism
hsa  Homo sapiens (human)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:hsa00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q13
AA seq 428 aa AA seqDB search
MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEFVSVRHLELAGENPSSDINCT
KVLQGDVNEIQKVKLEILTVKFKKRPRWTPDDYINMTSDCSSFIKRRKYIVEPLSKEEAE
FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASCFSNVFVAS
RLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGEN
NLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVL
QNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAVARFVKWQYFE
GDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRH
KALETLKH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggacgttgctgcgaaggagacttttttcttatcccaccaaatactactttatg
gttcttgttttatccctaatcaccttctccgttttaaggattcatcaaaagcctgaattt
gtaagtgtcagacacttggagcttgctggggagaatcctagtagtgatattaattgcacc
aaagttttacagggtgatgtaaatgaaatccaaaaggtaaagcttgagatcctaacagtg
aaatttaaaaagcgccctcggtggacacctgacgactatataaacatgaccagtgactgt
tcttctttcatcaagagacgcaaatatattgtagaaccccttagtaaagaagaggcggag
tttccaatagcatattctatagtggttcatcacaagattgaaatgcttgacaggctgctg
agggccatctatatgcctcagaatttctattgcattcatgtggacacaaaatccgaggat
tcctatttagctgcagtgatgggcatcgcttcctgttttagtaatgtctttgtggccagc
cgattggagagtgtggtttatgcatcgtggagccgggttcaggctgacctcaactgcatg
aaggatctctatgcaatgagtgcaaactggaagtacttgataaatctttgtggtatggat
tttcccattaaaaccaacctagaaattgtcaggaagctcaagttgttaatgggagaaaac
aacctggaaacggagaggatgccatcccataaagaagaaaggtggaagaagcggtatgag
gtcgttaatggaaagctgacaaacacagggactgtcaaaatgcttcctccactcgaaaca
cctctcttttctggcagtgcctacttcgtggtcagtagggagtatgtggggtatgtacta
cagaatgaaaaaatccaaaagttgatggagtgggcacaagacacatacagccctgatgag
tatctctgggccaccatccaaaggattcctgaagtcccgggctcactccctgccagccat
aagtatgatctgtctgacatgcaagcagttgccaggtttgtcaagtggcagtactttgag
ggtgatgtttccaagggtgctccctacccgccctgcgatggagtccatgtgcgctcagtg
tgcattttcggagctggtgacttgaactggatgctgcgcaaacaccacttgtttgccaat
aagtttgacgtggatgttgacctctttgccatccagtgtttggatgagcatttgagacac
aaagctttggagacattaaaacactga

DBGET integrated database retrieval system