KEGG   Homo sapiens (human): 2651Help
Entry
2651              CDS       T01001                                 

Gene name
GCNT2, CCAT, CTRCT13, GCNT2C, GCNT5, IGNT, II, NACGT1, NAGCT1, ULG3, bA360O19.2, bA421M1.1
Definition
(RefSeq) glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) (EC:2.4.1.150)
  KO
K00742  
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase [EC:2.4.1.150]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Disease
H01013  
Adult i phenotype
H01202  
Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    2651 (GCNT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.150  N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
     2651 (GCNT2)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  I antigen
   2651 (GCNT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p24.2
AA seq 402 aa AA seqDB search
MMGSWKHCLFSASLISALIFVFVYNTELWENKRFLRAALSNASLLAEACHQIFEGKVFYP
TENALKTTLDEATCYEYMVRSHYVTETLSEEEAGFPLAYTVTIHKDFGTFERLFRAIYMP
QNVYCVHLDQKATDAFKGAVKQLLSCFPNAFLASKKESVVYGGISRLQADLNCLEDLVAS
EVPWKYVINTCGQDFPLKTNREIVQYLKGFKGKNITPGVLPPDHAVGRTKYVHQELLNHK
NSYVIKTTKLKTPPPHDMVIYFGTAYVALTRDFANFVLQDQLALDLLSWSKDTYSPDEHF
WVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNS
PSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgatgggctcttggaagcactgtctttttagcgcgtctcttatctctgccctgattttt
gtatttgtttacaatactgagttatgggagaataaacgttttctgagggcagctctgtcc
aatgcttcactgttagcagaagcctgtcatcagatttttgaggggaaagttttttaccca
acagaaaatgcattgaaaactacccttgatgaagctacctgctatgagtacatggttcga
agccactatgtaacagaaacactctctgaagaagaggctgggttccctttagcttacaca
gtgaccatccacaaagacttcggcacttttgagaggctcttcagggcgatttatatgccc
caaaatgtctactgtgtgcacctggatcagaaggcgacggatgcctttaaaggtgcagtg
aaacagttactcagctgcttcccaaatgcttttctggcttccaagaaggagtcggttgtc
tatggggggatctccaggctccaggctgacctgaactgcctggaagaccttgtggcctct
gaagttccctggaagtatgtcatcaacacctgcgggcaagactttcccctgaaaaccaac
agggaaatagttcagtatctgaagggatttaaagggaaaaatatcacccccggagtgctg
cctcctgaccacgctgttggacggactaaatacgtccaccaagaactgttaaaccacaaa
aattcctacgtgattaaaacaacaaaattaaaaactcctcctcctcatgacatggtgatt
tactttggcacggcctacgtggctctcacaagggactttgctaacttcgtcctccaagac
cagctcgcacttgacttactctcctggtccaaggacacctacagccccgacgaacatttc
tgggtgacactcaacaggattcccggtgttcctggctctatgccaaatgcatcctggact
ggaaacctcagagctataaagtggagtgacatggaagacagacacggaggctgccacggc
cactatgtacatggtatttgtatctatggaaacggagacttaaagtggctggttaattca
ccaagcctgtttgctaacaagtttgagcttaatacctacccccttactgtggaatgccta
gaactgaggcatcgcgaaagaaccctcaatcagagtgaaactgcgatacaacccagctgg
tatttttga

DBGET integrated database retrieval system