KEGG   Homo sapiens (human): 9245Help
Entry
9245              CDS       T01001                                 

Gene name
GCNT3, C2/4GnT, C24GNT, C2GNT2, C2GNTM, GNTM
Definition
glucosaminyl (N-acetyl) transferase 3, mucin type (EC:2.4.1.102 2.4.1.150)
Orthology
K09662  
N-acetylglucosaminyltransferase 3, mucin type [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:hsa00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q21.3
AA seq 438 aa AA seqDB search
MVQWKRLCQLHYLWALGCYMLLATVALKLSFRLKCDSDHLGLESRESQSQYCRNILYNFL
KLPAKRSINCSGVTRGDQEAVLQAILNNLEVKKKREPFTDTHYLSLTRDCEHFKAERKFI
QFPLSKEEVEFPIAYSMVIHEKIENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAII
SCFPNVFIASKLVRVVYASWSRVQADLNCMEDLLQSSVPWKYFLNTCGTDFPIKSNAEMV
QALKMLNGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTNKKKDPPPYNLTMFTGNAYIV
ASRDFVQHVLKNPKSQQLIEWVKDTYSPDEHLWATLQRARWMPGSVPNHPKYDISDMTSI
ARLVKWQGHEGDIDKGAPYAPCSGIHQRAICVYGAGDLNWMLQNHHLLANKFDPKVDDNA
LQCLEEYLRYKAIYGTEL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggttcaatggaagagactctgccagctgcattacttgtgggctctgggctgctatatg
ctgctggccactgtggctctgaaactttctttcaggttgaagtgtgactctgaccacttg
ggtctggagtccagggaatctcaaagccagtactgtaggaatatcttgtataatttcctg
aaacttccagcaaagaggtctatcaactgttcaggggtcacccgaggggaccaagaggca
gtgcttcaggctattctgaataacctggaggtcaagaagaagcgagagcctttcacagac
acccactacctctccctcaccagagactgtgagcacttcaaggctgaaaggaagttcata
cagttcccactgagcaaagaagaggtggagttccctattgcatactctatggtgattcat
gagaagattgaaaactttgaaaggctactgcgagctgtgtatgcccctcagaacatatac
tgtgtccatgtggatgagaagtccccagaaactttcaaagaggcggtcaaagcaattatt
tcttgcttcccaaatgtcttcatagccagtaagctggttcgggtggtttatgcctcctgg
tccagggtgcaagctgacctcaactgcatggaagacttgctccagagctcagtgccgtgg
aaatacttcctgaatacatgtgggacggactttcctataaagagcaatgcagagatggtc
caggctctcaagatgttgaatgggaggaatagcatggagtcagaggtacctcctaagcac
aaagaaacccgctggaaatatcactttgaggtagtgagagacacattacacctaaccaac
aagaagaaggatcctcccccttataatttaactatgtttacagggaatgcgtacattgtg
gcttcccgagatttcgtccaacatgttttgaagaaccctaaatcccaacaactgattgaa
tgggtaaaagacacttatagcccagatgaacacctctgggccacccttcagcgtgcacgg
tggatgcctggctctgttcccaaccaccccaagtacgacatctcagacatgacttctatt
gccaggctggtcaagtggcagggtcatgagggagacatcgataagggtgctccttatgct
ccctgctctggaatccaccagcgggctatctgcgtttatggggctggggacttgaattgg
atgcttcaaaaccatcacctgttggccaacaagtttgacccaaaggtagatgataatgct
cttcagtgcttagaagaatacctacgttataaggccatctatgggactgaactttga

DBGET integrated database retrieval system