KEGG   Homo sapiens (human): 51301Help
Entry
51301             CDS       T01001                                 

Gene name
GCNT4, C2GNT3
Definition
glucosaminyl (N-acetyl) transferase 4, core 2 (EC:2.4.1.102)
Orthology
K09663  
beta-1,6-N-acetylglucosaminyltransferase 4 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    51301 (GCNT4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     51301 (GCNT4)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   51301 (GCNT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Position
5q12
AA seq 453 aa AA seqDB search
MKIFKCYFKHTLQQKVFILFLTLWLLSLLKLLNVRRLFPQKDIYLVEYSLSTSPFVRNRY
THVKDEVRYEVNCSGIYEQEPLEIGKSLEIRRRDIIDLEDDDVVAMTSDCDIYQTLRGYA
QKLVSKEEKSFPIAYSLVVHKDAIMVERLIHAIYNQHNIYCIHYDRKAPDTFKVAMNNLA
KCFSNIFIASKLEAVEYAHISRLQADLNCLSDLLKSSIQWKYVINLCGQDFPLKSNFELV
SELKKLNGANMLETVKPPNSKLERFTYHHELRRVPYEYVKLPIRTNISKEAPPHNIQIFV
GSAYFVLSQAFVKYIFNNSIVQDFFAWSKDTYSPDEHFWATLIRVPGIPGEISRSAQDVS
DLQSKTRLVKWNYYEGFFYPSCTGSHLRSVCIYGAAELRWLIKDGHWFANKFDSKVDPIL
IKCLAEKLEEQQRDWITLPSEKLFMDRNLTTTS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattcaaatgttattttaaacataccctacagcagaaagttttcatcctgttt
ttaaccctatggctgctctctttgttaaagcttctaaatgtgagacgactctttccgcaa
aaagacatttacttggttgagtactccctaagtacctcgccttttgtaagaaacagatac
actcatgttaaggatgaagtcaggtatgaagttaactgttcgggtatctatgaacaggag
cctttggaaattggaaagagtctggaaataagaagaagggacatcattgacttggaggat
gatgatgttgtggcaatgaccagtgattgtgacatttatcagactctaagaggttatgct
caaaagcttgtctcaaaggaggagaaaagcttcccaatagcctattctttggttgtccac
aaagatgcaattatggttgaaaggcttatccatgctatatacaaccagcacaatatttac
tgcatccattatgatcgtaaggcacctgataccttcaaagttgccatgaacaatttagct
aagtgcttctccaatattttcattgcttccaaattagaggctgtggaatatgcccacatt
tccagactccaggctgatttaaattgcttgtcggaccttctgaagtcttcaatccagtgg
aaatatgttatcaacttgtgtgggcaagattttcccctgaagtcaaattttgaattggtg
tcagagttgaaaaaactcaatggagcaaatatgttggagacggtgaaacccccaaacagt
aaattggaaagattcacttaccatcatgaacttagacgggtgccttatgaatatgtgaag
ctaccaataaggacaaacatctccaaggaagcacccccccataacattcagatatttgtt
ggcagtgcttattttgttttaagtcaagcatttgttaaatatattttcaacaactccatc
gttcaagacttttttgcctggtctaaagacacatactctcctgatgagcacttttgggct
accttgattcgggttccaggaatacctggggagatttccagatcagcccaggatgtgtct
gatctgcagagtaagactcgccttgtcaagtggaattactatgaaggctttttctatccc
agttgtactggatctcaccttcgaagcgtgtgtatttatggagctgcagaattaaggtgg
cttatcaaagatggacattggtttgctaataaatttgattctaaggtggaccctatcttg
attaaatgcttggcagaaaagcttgaagaacagcagagagactggatcactttgccctca
gaaaagttatttatggatagaaatctcactaccacatcatga

DBGET integrated database retrieval system