KEGG   Homo sapiens (human): 2990Help
Entry
2990              CDS       T01001                                 

Gene name
GUSB, BG, MPS7
Definition
glucuronidase, beta (EC:3.2.1.31)
Orthology
K01195  
beta-glucuronidase [EC:3.2.1.31]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Glycosaminoglycan degradation
Porphyrin and chlorophyll metabolism
Drug metabolism - other enzymes
Metabolic pathways
Lysosome
Module
Dermatan sulfate degradation
Chondroitin sulfate degradation
Heparan sulfate degradation
Disease
H00132  
Mucopolysaccharidosis type VII (MPS7)
H00421  
Mucopolysaccharidosis (MPS)
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:hsa00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hsa00500]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:hsa00531]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hsa00860]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:hsa00983]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21.11
AA seq 651 aa AA seqDB search
MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFE
EQWYRRPLWESGPTVDMPVPSSFNDISQDWRLRHFVGWVWYEREVILPERWTQDLRTRVV
LRIGSAHSYAIVWVNGVDTLEHEGGYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTT
LPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTSVEQD
SGLVNYQISVKGSNLFKLEVRLLDAENKVVANGTGTQGQLKVPGVSLWWPYLMHERPAYL
YSLEVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNKHEDADIRGKG
FDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNN
VSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMVIAHTKSLDPSRPVT
FVSNSNYAADKGAPYVDVICLNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSE
YGAETIAGFHQDPPLMFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTR
VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSLFT
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggggtcggcggttgcctgggcggcgctcgggccgttgttgtggggctgcgcg
ctggggctgcagggcgggatgctgtacccccaggagagcccgtcgcgggagtgcaaggag
ctggacggcctctggagcttccgcgccgacttctctgacaaccgacgccggggcttcgag
gagcagtggtaccggcggccgctgtgggagtcaggccccaccgtggacatgccagttccc
tccagcttcaatgacatcagccaggactggcgtctgcggcattttgtcggctgggtgtgg
tacgaacgggaggtgatcctgccggagcgatggacccaggacctgcgcacaagagtggtg
ctgaggattggcagtgcccattcctatgccatcgtgtgggtgaatggggtcgacacgcta
gagcatgaggggggctacctccccttcgaggccgacatcagcaacctggtccaggtgggg
cccctgccctcccggctccgaatcactatcgccatcaacaacacactcacccccaccacc
ctgccaccagggaccatccaatacctgactgacacctccaagtatcccaagggttacttt
gtccagaacacatattttgactttttcaactacgctggactgcagcggtctgtacttctg
tacacgacacccaccacctacatcgatgacatcaccgtcaccaccagcgtggagcaagac
agtgggctggtgaattaccagatctctgtcaagggcagtaacctgttcaagttggaagtg
cgtcttttggatgcagaaaacaaagtcgtggcgaatgggactgggacccagggccaactt
aaggtgccaggtgtcagcctctggtggccgtacctgatgcacgaacgccctgcctatctg
tattcattggaggtgcagctgactgcacagacgtcactggggcctgtgtctgacttctac
acactccctgtggggatccgcactgtggctgtcaccaagagccagttcctcatcaatggg
aaacctttctatttccacggtgtcaacaagcatgaggatgcggacatccgagggaagggc
ttcgactggccgctgctggtgaaggacttcaacctgcttcgctggcttggtgccaacgct
ttccgtaccagccactacccctatgcagaggaagtgatgcagatgtgtgaccgctatggg
attgtggtcatcgatgagtgtcccggcgtgggcctggcgctgccgcagttcttcaacaac
gtttctctgcatcaccacatgcaggtgatggaagaagtggtgcgtagggacaagaaccac
cccgcggtcgtgatgtggtctgtggccaacgagcctgcgtcccacctagaatctgctggc
tactacttgaagatggtgatcgctcacaccaaatccttggacccctcccggcctgtgacc
tttgtgagcaactctaactatgcagcagacaagggggctccgtatgtggatgtgatctgt
ttgaacagctactactcttggtatcacgactacgggcacctggagttgattcagctgcag
ctggccacccagtttgagaactggtataagaagtatcagaagcccattattcagagcgag
tatggagcagaaacgattgcagggtttcaccaggatccacctctgatgttcactgaagag
taccagaaaagtctgctagagcagtaccatctgggtctggatcaaaaacgcagaaaatac
gtggttggagagctcatttggaattttgccgatttcatgactgaacagtcaccgacgaga
gtgctggggaataaaaaggggatcttcactcggcagagacaaccaaaaagtgcagcgttc
cttttgcgagagagatactggaagattgccaatgaaaccaggtatccccactcagtagcc
aagtcacaatgtttggaaaacagcctgtttacttga

DBGET integrated database retrieval system