KEGG   Homo sapiens (human): 2990Help
Entry
2990              CDS       T01001                                 

Gene name
GUSB, BG, MPS7
Definition
glucuronidase, beta (EC:3.2.1.31)
Orthology
K01195  
beta-glucuronidase [EC:3.2.1.31]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Glycosaminoglycan degradation
Porphyrin and chlorophyll metabolism
Drug metabolism - other enzymes
Metabolic pathways
Lysosome
Module
Glucuronate pathway (uronate pathway)
Dermatan sulfate degradation
Chondroitin sulfate degradation
Heparan sulfate degradation
Disease
H00132  
Mucopolysaccharidosis type VII (MPS7)
H00421  
Mucopolysaccharidosis (MPS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    2990 (GUSB)
   00500 Starch and sucrose metabolism
    2990 (GUSB)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    2990 (GUSB)
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    2990 (GUSB)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    2990 (GUSB)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    2990 (GUSB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     2990 (GUSB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21.11
AA seq 651 aa AA seqDB search
MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFE
EQWYRRPLWESGPTVDMPVPSSFNDISQDWRLRHFVGWVWYEREVILPERWTQDLRTRVV
LRIGSAHSYAIVWVNGVDTLEHEGGYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTT
LPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTSVEQD
SGLVNYQISVKGSNLFKLEVRLLDAENKVVANGTGTQGQLKVPGVSLWWPYLMHERPAYL
YSLEVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNKHEDADIRGKG
FDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNN
VSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMVIAHTKSLDPSRPVT
FVSNSNYAADKGAPYVDVICLNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSE
YGAETIAGFHQDPPLMFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTR
VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSLFT
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggggtcggcggttgcctgggcggcgctcgggccgttgttgtggggctgcgcg
ctggggctgcagggcgggatgctgtacccccaggagagcccgtcgcgggagtgcaaggag
ctggacggcctctggagcttccgcgccgacttctctgacaaccgacgccggggcttcgag
gagcagtggtaccggcggccgctgtgggagtcaggccccaccgtggacatgccagttccc
tccagcttcaatgacatcagccaggactggcgtctgcggcattttgtcggctgggtgtgg
tacgaacgggaggtgatcctgccggagcgatggacccaggacctgcgcacaagagtggtg
ctgaggattggcagtgcccattcctatgccatcgtgtgggtgaatggggtcgacacgcta
gagcatgaggggggctacctccccttcgaggccgacatcagcaacctggtccaggtgggg
cccctgccctcccggctccgaatcactatcgccatcaacaacacactcacccccaccacc
ctgccaccagggaccatccaatacctgactgacacctccaagtatcccaagggttacttt
gtccagaacacatattttgactttttcaactacgctggactgcagcggtctgtacttctg
tacacgacacccaccacctacatcgatgacatcaccgtcaccaccagcgtggagcaagac
agtgggctggtgaattaccagatctctgtcaagggcagtaacctgttcaagttggaagtg
cgtcttttggatgcagaaaacaaagtcgtggcgaatgggactgggacccagggccaactt
aaggtgccaggtgtcagcctctggtggccgtacctgatgcacgaacgccctgcctatctg
tattcattggaggtgcagctgactgcacagacgtcactggggcctgtgtctgacttctac
acactccctgtggggatccgcactgtggctgtcaccaagagccagttcctcatcaatggg
aaacctttctatttccacggtgtcaacaagcatgaggatgcggacatccgagggaagggc
ttcgactggccgctgctggtgaaggacttcaacctgcttcgctggcttggtgccaacgct
ttccgtaccagccactacccctatgcagaggaagtgatgcagatgtgtgaccgctatggg
attgtggtcatcgatgagtgtcccggcgtgggcctggcgctgccgcagttcttcaacaac
gtttctctgcatcaccacatgcaggtgatggaagaagtggtgcgtagggacaagaaccac
cccgcggtcgtgatgtggtctgtggccaacgagcctgcgtcccacctagaatctgctggc
tactacttgaagatggtgatcgctcacaccaaatccttggacccctcccggcctgtgacc
tttgtgagcaactctaactatgcagcagacaagggggctccgtatgtggatgtgatctgt
ttgaacagctactactcttggtatcacgactacgggcacctggagttgattcagctgcag
ctggccacccagtttgagaactggtataagaagtatcagaagcccattattcagagcgag
tatggagcagaaacgattgcagggtttcaccaggatccacctctgatgttcactgaagag
taccagaaaagtctgctagagcagtaccatctgggtctggatcaaaaacgcagaaaatac
gtggttggagagctcatttggaattttgccgatttcatgactgaacagtcaccgacgaga
gtgctggggaataaaaaggggatcttcactcggcagagacaaccaaaaagtgcagcgttc
cttttgcgagagagatactggaagattgccaatgaaaccaggtatccccactcagtagcc
aagtcacaatgtttggaaaacagcctgtttacttga

DBGET integrated database retrieval system