KEGG   Homo sapiens (human): 2998Help
Entry
2998              CDS       T01001                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2 (liver) (EC:2.4.1.11)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Disease
H00069  
Glycogen storage diseases (GSD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    2998 (GYS2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    2998 (GYS2)
   04152 AMPK signaling pathway
    2998 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    2998 (GYS2)
   04922 Glucagon signaling pathway
    2998 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    2998 (GYS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     2998 (GYS2)
Glycosyltransferases [BR:hsa01003]
 Polysaccharide
  Storage polysaccharide
   2998 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p12.2
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLGGLPQWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKYVVAQFH
EWQAGIGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDI
TVMVFFIMPAKTNNFNVETLKGQAVRKQLWDVAHSVKEKFGKKLYDALLRGEIPDLNDIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVE
DEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggccgatccctctctgtaacatccctgggtgggcttccccagtgggaagtc
gaagaacttcctgtggaggagttactgctctttgaagttgcttgggaagtgaccaataaa
gttggaggcatctatactgtgattcagacaaaggccaaaacaacagcagatgaatgggga
gagaactattttctgataggtccatattttgagcataatatgaagactcaggtggaacag
tgtgaacctgtaaatgatgctgtcagaagagcagtggacgcaatgaataagcatggctgc
caggtgcattttggaagatggctgatagaaggaagtccttatgtggtactttttgacata
ggctattcagcttggaatctggacaggtggaagggtgacctctgggaagcatgcagtgtc
ggcattccttatcatgaccgagaagccaatgatatgctgatatttggatctttaactgcc
tggttcttaaaagaggtgacagatcatgcagatggtaaatatgtcgttgcccaattccat
gaatggcaggctggaattggactgatcctttctcgagccaggaaacttcctattgccaca
atatttacaacccacgctacactacttgggaggtatctctgtgcagcaaatattgatttc
tacaaccatcttgataagtttaacattgacaaagaggctggggaaaggcagatttaccac
cggtactgcatggagcgagcttccgttcattgcgctcacgtgttcaccacggtttctgaa
ataacagcaatagaagctgaacatatgctgaagagaaagcctgatgtagttactccaaac
ggcttgaatgttaagaaattttcagcagtgcatgagtttcaaaatctacatgccatgtac
aaggccagaatccaagattttgttcgaggtcatttctatggtcatctcgactttgatctt
gaaaagactttgttccttttcattgctgggaggtatgagttttcaaacaaaggagctgac
atcttcctagaatccttatccaggctaaatttcctgctgaggatgcataaaagtgacatc
acagtgatggtgtttttcattatgcctgccaagacaaataatttcaacgtggaaaccctg
aaaggacaagcagtgcgaaaacagctgtgggatgttgcacattctgtgaaggaaaagttt
ggaaaaaaactctatgatgcattattaagaggagaaattcctgacctgaacgatatttta
gatcgagatgatctaacaattatgaaaagagccatcttttcaactcagcgacagtcattg
cccccagtgaccacgcacaacatgattgatgactccaccgaccccatcctcagcaccatt
agacggattggacttttcaacaaccgcacagatagagtcaaggtgattttgcacccagag
tttctatcctccaccagtcccttactacccatggactatgaagagtttgttagaggttgt
catcttggagtatttccatcatactatgaaccctggggttatactccagctgaatgcact
gtgatgggtatccccagtgtgaccacgaatctctccgggtttggctgtttcatgcaggag
cacgtggctgatcctactgcttacggtatttacatcgttgacaggcggttccgttctcca
gatgattcttgcaatcagctgactaagtttctctatggattttgcaaacagtcacgccgc
caaaggattatccagaggaacagaactgagaggctctcagatcttctggattggagatac
ttaggcagatattaccagcatgccagacacctgacattaagcagagcttttccagataaa
ttccatgtggaactaacatcaccaccaacgacagaaggatttaaatatcccaggccttcc
tcagtaccaccttctccttcagggtctcaggcctccagtcctcagagcagtgatgtggaa
gatgaagtggaggatgagagatacgatgaggaagaggaggctgaaagggatcggttaaat
atcaagtcaccattttcactgagccacgttcctcatgggaagaaaaagctgcatggtgaa
tataagaactga

DBGET integrated database retrieval system