KEGG   Homo sapiens (human): 3938Help
Entry
3938              CDS       T01001                                 

Gene name
LCT, LAC, LPH, LPH1
Definition
lactase (EC:3.2.1.108 3.2.1.62)
Orthology
K01229  
lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
hsa  Homo sapiens (human)
Pathway
Galactose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Disease
H00116  
Congenital lactase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    3938 (LCT)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    3938 (LCT)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     3938 (LCT)
    3.2.1.108  lactase
     3938 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q21
AA seq 1927 aa AA seqDB search
MELSWHVVFIALLSFSCWGSDWESDRNFISTAGPLTNDLLHNLSGLLGDQSSNFVAGDKD
MYVCHQPLPTFLPEYFSSLHASQITHYKVFLSWAQLLPAGSTQNPDEKTVQCYRRLLKAL
KTARLQPMVILHHQTLPASTLRRTEAFADLFADYATFAFHSFGDLVGIWFTFSDLEEVIK
ELPHQESRASQLQTLSDAHRKAYEIYHESYAFQGGKLSVVLRAEDIPELLLEPPISALAQ
DTVDFLSLDLSYECQNEASLRQKLSKLQTIEPKVKVFIFNLKLPDCPSTMKNPASLLFSL
FEAINKDQVLTIGFDINEFLSCSSSSKKSMSCSLTGSLALQPDQQQDHETTDSSPASAYQ
RIWEAFANQSRAERDAFLQDTFPEGFLWGASTGAFNVEGGWAEGGRGVSIWDPRRPLNTT
EGQATLEVASDSYHKVASDVALLCGLRAQVYKFSISWSRIFPMGHGSSPSLPGVAYYNKL
IDRLQDAGIEPMATLFHWDLPQALQDHGGWQNESVVDAFLDYAAFCFSTFGDRVKLWVTF
HEPWVMSYAGYGTGQHPPGISDPGVASFKVAHLVLKAHARTWHHYNSHHRPQQQGHVGIV
LNSDWAEPLSPERPEDLRASERFLHFMLGWFAHPVFVDGDYPATLRTQIQQMNRQCSHPV
AQLPEFTEAEKQLLKGSADFLGLSHYTSRLISNAPQNTCIPSYDTIGGFSQHVNHVWPQT
SSSWIRVVPWGIRRLLQFVSLEYTRGKVPIYLAGNGMPIGESENLFDDSLRVDYFNQYIN
EVLKAIKEDSVDVRSYIARSLIDGFEGPSGYSQRFGLHHVNFSDSSKSRTPRKSAYFFTS
IIEKNGFLTKGAKRLLPPNTVNLPSKVRAFTFPSEVPSKAKVVWEKFSSQPKFERDLFYH
GTFRDDFLWGVSSSAYQIEGAWDADGKGPSIWDNFTHTPGSNVKDNATGDIACDSYHQLD
ADLNMLRALKVKAYRFSISWSRIFPTGRNSSINSHGVDYYNRLINGLVASNIFPMVTLFH
WDLPQALQDIGGWENPALIDLFDSYADFCFQTFGDRVKFWMTFNEPMYLAWLGYGSGEFP
PGVKDPGWAPYRIAHAVIKAHARVYHTYDEKYRQEQKGVISLSLSTHWAEPKSPGVPRDV
EAADRMLQFSLGWFAHPIFRNGDYPDTMKWKVGNRSELQHLATSRLPSFTEEEKRFIRAT
ADVFCLNTYYSRIVQHKTPRLNPPSYEDDQEMAEEEDPSWPSTAMNRAAPWGTRRLLNWI
KEEYGDIPIYITENGVGLTNPNTEDTDRIFYHKTYINEALKAYRLDGIDLRGYVAWSLMD
NFEWLNGYTVKFGLYHVDFNNTNRPRTARASARYYTEVITNNGMPLAREDEFLYGRFPEG
FIWSAASAAYQIEGAWRADGKGLSIWDTFSHTPLRVENDAIGDVACDSYHKIAEDLVTLQ
NLGVSHYRFSISWSRILPDGTTRYINEAGLNYYVRLIDTLLAASIQPQVTIYHWDLPQTL
QDVGGWENETIVQRFKEYADVLFQRLGDKVKFWITLNEPFVIAYQGYGYGTAAPGVSNRP
GTAPYIVGHNLIKAHAEAWHLYNDVYRASQGGVISITISSDWAEPRDPSNQEDVEAARRY
VQFMGGWFAHPIFKNGDYNEVMKTRIRDRSLAAGLNKSRLPEFTESEKRRINGTYDFFGF
NHYTTVLAYNLNYATAISSFDADRGVASIADRSWPDSGSFWLKMTPFGFRRILNWLKEEY
NDPPIYVTENGVSQREETDLNDTARIYYLRTYINEALKAVQDKVDLRGYTVWSAMDNFEW
ATGFSERFGLHFVNYSDPSLPRIPKASAKFYASVVRCNGFPDPATGPHACLHQPDAGPTI
SPVRQEEVQFLGLMLGTTEAQTALYVLFSLVLLGVCGLAFLSYKYCKRSKQGKTQRSQQE
LSPVSSF
NT seq 5784 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtcttggcatgtagtctttattgccctgctaagtttttcatgctgggggtca
gactgggagtctgatagaaatttcatttccaccgctggtcctctaaccaatgacttgctg
cacaacctgagtggtctcctgggagaccagagttctaactttgtagcaggggacaaagac
atgtatgtttgtcaccagccactgcccactttcctgccagaatacttcagcagtctccat
gccagtcagatcacccattataaggtatttctgtcatgggcacagctcctcccagcagga
agcacccagaatccagacgagaaaacagtgcagtgctaccggcgactcctcaaggccctc
aagactgcacggcttcagcccatggtcatcctgcaccaccagaccctccctgccagcacc
ctccggagaaccgaagcctttgctgacctcttcgccgactatgccacattcgccttccac
tccttcggggacctagttgggatctggttcaccttcagtgacttggaggaagtgatcaag
gagcttccccaccaggaatcaagagcgtcacaactccagaccctcagtgatgcccacaga
aaagcctatgagatttaccacgaaagctatgcttttcagggcggaaaactctctgttgtc
ctgcgagctgaagatatcccggagctcctgctagaaccacccatatctgcgcttgcccag
gacacggtcgatttcctctctcttgatttgtcttatgaatgccaaaatgaggcaagtctg
cggcagaagctgagtaaattgcagaccattgagccaaaagtgaaagttttcatcttcaac
ctaaaactcccagactgcccctccaccatgaagaacccagccagtctgctcttcagcctt
tttgaagccataaataaagaccaagtgctcaccattgggtttgatattaatgagtttctg
agttgttcatcaagttccaagaaaagcatgtcttgttctctgactggcagcctggccctt
cagcctgaccagcagcaggaccacgagaccacggactcctctcctgcctctgcctatcag
agaatctgggaagcatttgccaatcagtccagggcggaaagggatgccttcctgcaggat
actttccctgaaggcttcctctggggtgcctccacaggagcctttaacgtggaaggaggc
tgggccgagggtgggagaggggtgagcatctgggatccacgcaggcccctgaacaccact
gagggccaagcgacgctggaggtggccagcgacagttaccacaaggtagcctctgacgtc
gccctgctttgcggcctccgggctcaggtgtacaagttctccatctcctggtcccggatc
ttccccatggggcacgggagcagccccagcctcccaggcgttgcctactacaacaagctg
attgacaggctacaggatgcgggcatcgagcccatggccacgctgttccactgggacctg
cctcaggccctgcaggatcatggtggatggcagaatgagagcgtggtggatgccttcctg
gactatgcggccttctgcttctccacatttggggaccgtgtgaagctgtgggtgaccttc
catgagccgtgggtgatgagctacgcaggctatggcaccggccagcaccctcccggcatc
tctgacccaggagtggcctcttttaaggtggctcacttggtcctcaaggctcatgccaga
acttggcaccactacaacagccatcatcgcccacagcagcaggggcacgtgggcattgtg
ctgaactcagactgggcagaacccctgtctccagagaggcctgaggacctgagagcctct
gagcgcttcttgcacttcatgctgggctggtttgcacaccccgtctttgtggatggagac
tacccagccaccctgaggacccagatccaacagatgaacagacagtgctcccatcctgtg
gctcaactccccgagttcacagaggcagagaagcagctcctgaaaggctctgctgatttt
ctgggtctgtcgcattacacctcccgcctcatcagcaacgccccacaaaacacctgcatc
cctagctatgataccattggaggcttctcccaacacgtgaaccatgtgtggccccagacc
tcatcctcttggattcgtgtggtgccctgggggataaggaggctgttgcagtttgtatcc
ctggaatacacaagaggaaaagttccaatataccttgccgggaatggcatgcccataggg
gaaagtgaaaatctctttgatgattccttaagagtagactacttcaatcaatatatcaat
gaggtgctcaaggctatcaaggaagactctgtggatgttcgttcctacattgctcgttcc
ctcattgatggcttcgaaggcccttctggttacagccagcggtttggcctgcaccacgtc
aacttcagcgacagcagcaagtcaaggactcccaggaaatctgcctactttttcactagc
atcatagaaaagaacggtttcctcaccaagggggcaaaaagactgctaccacctaataca
gtaaacctcccctccaaagtcagagccttcacttttccatctgaggtgccctccaaggct
aaagtcgtttgggaaaagttctccagccaacccaagttcgaaagagatttgttctaccac
gggacgtttcgggatgactttctgtggggcgtgtcctcttccgcttatcagattgaaggc
gcgtgggatgccgatggcaaaggccccagcatctgggataactttacccacacaccaggg
agcaatgtgaaagacaatgccactggagacatcgcctgtgacagctatcaccagctggat
gccgatctgaatatgctccgagctttgaaggtgaaggcctaccgcttctctatctcctgg
tctcggattttcccaactgggagaaacagctctatcaacagtcatggggttgattattac
aacaggctgatcaatggcttggtggcaagcaacatctttcccatggtgacattgttccat
tgggacctgccccaggccctccaggatatcggaggctgggagaatcctgccttgattgac
ttgtttgacagctacgcagacttttgtttccagacctttggtgatagagtcaagttttgg
atgacttttaatgagcccatgtacctggcatggctaggttatggctcaggggaatttccc
ccaggggtgaaggacccaggctgggcaccatataggatagcccacgccgtcatcaaagcc
catgccagagtctatcacacgtacgatgagaaatacaggcaggagcagaagggggtcatc
tcgctgagcctcagtacacactgggcagagcccaagtcaccaggggtccccagagatgtg
gaagccgctgaccgaatgctgcagttctccctgggctggtttgctcaccccatttttaga
aacggagactatcctgacaccatgaagtggaaagtggggaacaggagtgaactgcagcac
ttagccacctcccgcctgccaagcttcactgaggaagagaagaggttcatcagggcgacg
gccgacgtcttctgcctcaacacgtactactccagaatcgtgcagcacaaaacacccagg
ctaaacccaccctcctacgaagacgaccaggagatggctgaggaggaggacccttcgtgg
ccttccacggcaatgaacagagctgcgccctgggggacgcgaaggctgctgaactggatc
aaggaagagtatggtgacatccccatttacatcaccgaaaacggagtggggctgaccaat
ccgaacacggaggatactgataggatattttaccacaaaacctacatcaatgaggctttg
aaagcctacaggctcgatggtatagaccttcgagggtatgtcgcctggtctctgatggac
aactttgagtggctaaatggctacacggtcaagtttggactgtaccatgttgatttcaac
aacacgaacaggcctcgcacagcaagagcctccgccaggtactacacagaggtcattacc
aacaacggcatgccactggccagggaggatgagtttctgtacggacggtttcctgagggc
ttcatctggagtgcagcttctgctgcatatcagattgaaggtgcgtggagagcagatggc
aaaggactcagcatttgggacacgttttctcacacaccactgagggttgagaacgatgcc
attggagacgtggcctgtgacagttatcacaagattgctgaggatctggtcaccctgcag
aacctgggcgtgtcccactaccgtttttccatctcctggtctcgcatcctccctgatgga
accaccaggtacatcaatgaagcgggcctgaactactacgtgaggctcatcgatacactg
ctggccgccagcatccagccccaggtgaccatttaccactgggacctaccacagacgctc
caagatgtaggaggctgggagaatgagaccatcgtgcagcggtttaaggagtatgcagat
gtgctcttccagaggctgggagacaaggtgaagttttggatcacgctgaatgagcccttt
gtcattgcttaccagggctatggctacggaacagcagctccaggagtctccaataggcct
ggcactgccccctacattgttggccacaatctaataaaggctcatgctgaggcctggcat
ctgtacaacgatgtgtaccgcgccagtcaaggtggcgtgatttccatcaccatcagcagt
gactgggctgaacccagagatccctctaaccaggaggatgtggaggcagccaggagatat
gttcagttcatgggaggctggtttgcacatcctattttcaagaatggagattacaatgag
gtgatgaagacgcggatccgtgacaggagcttggctgcaggcctcaacaagtctcggctg
ccagaatttacagagagtgagaagaggaggatcaacggcacctatgacttttttgggttc
aatcactacaccactgtcctcgcctacaacctcaactatgccactgccatctcttctttt
gatgcagacagaggagttgcttccatcgcagatcgctcgtggccagactctggctccttc
tggctgaagatgacgccttttggcttcaggaggatcctgaactggttaaaggaggaatac
aatgaccctccaatttatgtcacagagaatggagtgtcccagcgggaagaaacagacctc
aatgacactgcaaggatctactaccttcggacttacatcaatgaggccctcaaagctgtg
caggacaaggtggaccttcgaggatacacagtttggagtgcgatggacaattttgagtgg
gccacaggcttttcagagagatttggtctgcattttgtgaactacagtgacccttctctg
ccaaggatccccaaagcatcagcgaagttctacgcctctgtggtccgatgcaatggcttc
cctgaccccgctacagggcctcacgcttgtctccaccagccagatgctggacccaccatc
agccccgtgagacaggaggaggtgcagttcctggggctaatgctcggcaccacagaagca
cagacagctttgtacgttctcttttctcttgtgcttcttggagtctgtggcttggcattt
ctgtcatacaagtactgcaagcgctctaagcaagggaaaacacaacgaagccaacaggaa
ttgagcccggtgtcttcattctga

DBGET integrated database retrieval system