KEGG   Homo sapiens (human): 4124Help
Entry
4124              CDS       T01001                                 

Gene name
MAN2A1, AMan_II, GOLIM7, MANA2, MANII
Definition
mannosidase, alpha, class 2A, member 1 (EC:3.2.1.114)
Orthology
K01231  
alpha-mannosidase II [EC:3.2.1.114]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4124 (MAN2A1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.114  mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase
     4124 (MAN2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q21.3
AA seq 1144 aa AA seqDB search
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPRNPRREGSFPQGQLSMLQEKIDHLER
LLAENNEIISNIRDSVINLSESVEDGPKSSQSNFSQGAGSHLLPSQLSLSVDTADCLFAS
QSGSHNSDVQMLDVYSLISFDNPDGGVWKQGFDITYESNEWDTEPLQVFVVPHSHNDPGW
LKTFNDYFRDKTQYIFNNMVLKLKEDSRRKFIWSEISYLSKWWDIIDIQKKDAVKSLIEN
GQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLENNIGVKPRSGWAIDPFGHSPTMAYL
LNRAGLSHMLIQRVHYAVKKHFALHKTLEFFWRQNWDLGSVTDILCHMMPFYSYDIPHTC
GPDPKICCQFDFKRLPGGRFGCPWGVPPETIHPGNVQSRARMLLDQYRKKSKLFRTKVLL
APLGDDFRYCEYTEWDLQFKNYQQLFDYMNSQSKFKVKIQFGTLSDFFDALDKADETQRD
KGQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESHLRAAEILYYFALRQAH
KYKINKFLSSSLYTALTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMVLEKIIG
NSAFLLILKDKLTYDSYSPDTFLEMDLKQKSQDSLPQKNIIRLSAEPRYLVVYNPLEQDR
ISLVSVYVSSPTVQVFSASGKPVEVQVSAVWDTANTISETAYEISFRAHIPPLGLKVYKI
LESASSNSHLADYVLYKNKVEDSGIFTIKNMINTEEGITLENSFVLLRFDQTGLMKQMMT
KEDGKHHEVNVQFSWYGTTIKRDKSGAYLFLPDGNAKPYVYTTPPFVRVTHGRIYSEVTC
FFDHVTHRVRLYHIQGIEGQSVEVSNIVDIRKVYNREIAMKISSDIKSQNRFYTDLNGYQ
IQPRMTLSKLPLQANVYPMTTMAYIQDAKHRLTLLSAQSLGVSSLNSGQIEVIMDRRLMQ
DDNRGLEQGIQDNKITANLFRILLEKRSAVNTEEEKKSVSYPSLLSHITSSLMNHPVIPM
ANKFSSPTLELQGEFSPLQSSLPCDIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFS
SKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFR
IQLR
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaagccgccagttcaccgtgttcggcagtgcgatcttctgtgtggtgattttc
tcgctctacctgatgctggaccggggtcacttagactaccccaggaacccgcgccgcgag
ggctccttccctcagggccagctctcaatgttgcaagaaaaaatagaccatttggagcgt
ttgctagctgagaataatgagatcatctcaaatattagagactcagtcatcaatttgagt
gagtctgtggaggatggtccgaaaagttcacaaagcaatttcagccaaggtgctggctca
catcttctgccctcacaattatccctctcagttgacactgcagactgtctgtttgcttca
caaagtggaagtcacaattcagatgtgcagatgttggatgtttacagtctaatttctttt
gacaatccagatggtggagtttggaagcaaggatttgacattacttatgaatctaatgaa
tgggacactgaaccccttcaagtctttgtggtgcctcattcccataacgacccaggttgg
ttgaagactttcaatgactactttagagacaagactcagtatatttttaataacatggtc
ctaaagctgaaagaagactcacggaggaagtttatttggtctgagatctcttacctttca
aagtggtgggatattatagatattcagaagaaggatgctgttaaaagtttaatagaaaat
ggtcagcttgaaattgtgacaggtggctgggttatgcctgatgaagctactccacattat
tttgccttaattgatcaactaattgaaggacatcagtggctggaaaataatataggagtg
aaacctcggtccggctgggctattgatccctttggacactcaccaacaatggcttatctt
ctaaaccgtgctggactttctcacatgcttatccagagagttcattatgcagttaaaaaa
cactttgcactgcataaaacattggagtttttttggagacagaattgggatctgggatct
gtcacagatattttatgccacatgatgcccttctacagctatgacatccctcacacttgt
ggacctgatcctaaaatatgctgccagtttgattttaaacgtcttcctggaggcagattt
ggttgtccctggggagtccccccagaaacaatacatcctggaaatgtccaaagcagggct
cggatgctactagatcagtaccgaaagaagtcaaagctttttcgtaccaaagttctcctg
gctccactaggagatgatttccgctactgtgaatacacggaatgggatttacagtttaag
aattatcagcagctttttgattatatgaattctcagtccaagtttaaagttaagatacag
tttggaactttatcagatttttttgatgcgctggataaagcagatgaaactcagagagac
aagggccaatcgatgttccctgttttaagtggagattttttcacttatgccgatcgagat
gatcattactggagtggctattttacatccagacccttttacaaacgaatggacagaatc
atggaatctcatttaagggctgctgaaattctttactatttcgccctgagacaagctcac
aaatacaagataaataaatttctctcatcatcactttacacggcactgacagaagccaga
aggaatttgggactgtttcaacatcatgatgctatcacaggaactgcaaaagactgggtg
gttgtggattatggtaccagactttttcattcgttaatggttttggagaagataattgga
aattctgcatttcttcttattttgaaggacaaactcacatacgactcttactctcctgat
accttcctggagatggatttgaaacaaaaatcacaagattctctgccacaaaaaaatata
ataaggctgagtgcggagccaaggtaccttgtggtctataatcctttagaacaagaccga
atctcgttggtctcagtctatgtgagttccccgacagtgcaagtgttctctgcttcagga
aaacctgtggaagttcaagtcagcgcagtttgggatacagcaaatactatttcagaaaca
gcctatgagatctcttttcgagcacatataccgccattgggactgaaagtgtataagatt
ttggaatcagcaagttcaaattcacatttagctgattatgtcttgtataagaataaagta
gaagatagcggaattttcaccataaagaatatgataaatactgaagaaggtataacacta
gagaactcctttgttttacttcggtttgatcaaactggacttatgaagcaaatgatgact
aaagaagatggtaaacaccatgaagtaaatgtgcaattttcatggtatggaaccacaatt
aaaagagacaaaagtggtgcctacctcttcttacctgatggtaatgccaagccttatgtt
tacacaacaccgccctttgtcagagtgacacatggaaggatttattcggaagtgacttgc
ttttttgaccatgttactcatagagtccgactataccacatacagggaatagaaggacag
tctgtggaagtttccaatattgtggacatccgaaaagtatataaccgtgagattgcaatg
aaaatttcttctgatataaaaagccaaaatagattttatactgacctaaatgggtaccag
attcaacctagaatgacactgagcaaattgcctcttcaagcaaatgtctatcccatgacc
acaatggcctatatccaggatgccaaacatcgtttgacactgctctctgctcagtcatta
ggggtttcgagtttgaatagtggtcagattgaagttatcatggatcgaagactcatgcaa
gatgataatcgtggccttgagcaaggtatccaggataacaagattacagctaatctattt
cgaatactactagaaaaaagaagtgctgttaatacggaagaagaaaagaagtcggtcagt
tatccttctctccttagccacataacttcttctctcatgaatcatccagtcattccaatg
gcaaataagttctcctcacctacccttgagctgcaaggtgaattctctccattacagtca
tctttgccttgtgacattcatctggttaatttgagaacaatacagtcaaaggtgggcaat
gggcactccaatgaggcagccttgatcctccacagaaaagggtttgattgtcggttctct
agcaaaggcacagggctgttttgttctactactcagggaaagatattggtacagaaactt
ttaaacaagtttattgtcgaaagtctcacaccttcatcactatccttgatgcattcacct
cccggcactcagaatataagtgagatcaacttgagtccaatggaaatcagcacattccga
atccagttgaggtga

DBGET integrated database retrieval system