KEGG   Homo sapiens (human): 4126Help
Entry
4126              CDS       T01001                                 

Gene name
MANBA, MANB1
Definition
mannosidase, beta A, lysosomal (EC:3.2.1.25)
Orthology
K01192  
beta-mannosidase [EC:3.2.1.25]
Organism
hsa  Homo sapiens (human)
Pathway
Other glycan degradation
Lysosome
Disease
H00140  
beta-Mannosidosis
H00422  
Glycoproteinoses
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4126 (MANBA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    4126 (MANBA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.25  beta-mannosidase
     4126 (MANBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q24
AA seq 879 aa AA seqDB search
MRLHLLLLLALCGAGTTAAELSYSLRGNWSICNGNGSLELPGAVPGCVHSALFQQGLIQD
SYYRFNDLNYRWVSLDNWTYSKEFKIPFEISKWQKVNLILEGVDTVSKILFNEVTIGETD
NMFNRYSFDITNVVRDVNSIELRFQSAVLYAAQQSKAHTRYQVPPDCPPLVQKGECHVNF
VRKEQCSFSWDWGPSFPTQGIWKDVRIEAYNICHLNYFTFSPIYDKSAQEWNLEIESTFD
VVSSKPVGGQVIVAIPKLQTQQTYSIELQPGKRIVELFVNISKNITVETWWPHGHGNQTG
YNMTVLFELDGGLNIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPIFLKGSNWIPA
DSFQDRVTSELLRLLLQSVVDANMNTLRVWGGGIYEQDEFYELCDELGIMVWQDFMFACA
LYPTDQGFLDSVTAEVAYQIKRLKSHPSIIIWSGNNENEEALMMNWYHISFTDRPIYIKD
YVTLYVKNIRELVLAGDKSRPFITSSPTNGAETVAEAWVSQNPNSNYFGDVHFYDYISDC
WNWKVFPKARFASEYGYQSWPSFSTLEKVSSTEDWSFNSKFSLHRQHHEGGNKQMLYQAG
LHFKLPQSTDPLRTFKDTIYLTQVMQAQCVKTETEFYRRSRSEIVDQQGHTMGALYWQLN
DIWQAPSWASLEYGGKWKMLHYFAQNFFAPLLPVGFENENTFYIYGVSDLHSDYSMTLSV
RVHTWSSLEPVCSRVTERFVMKGGEAVCLYEEPVSELLRRCGNCTRESCVVSFYLSADHE
LLSPTNYHFLSSPKEAVGLCKAQITAIISQQGDIFVFDLETSAVAPFVWLDVGSIPGRFS
DNGFLMTEKTRTILFYPWEPTSKNELEQSFHVTSLTDIY
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctccacctgctcctgctgctcgcgctgtgcggtgcaggcaccaccgccgcggag
ctcagttacagcttgcgtggcaactggagcatctgcaatgggaacggctcgctggagctg
cccggggcggtccctggctgcgtgcacagcgccttgttccagcagggcctgatccaggat
tcttactacagatttaatgaccttaactacagatgggtctctttggataactggacctat
agcaaagaatttaaaatcccctttgaaattagcaaatggcaaaaagtaaatttgattctt
gagggagtggatacggtttcaaaaatcctgttcaatgaagtcactattggggaaacagac
aatatgttcaatagatatagctttgatattaccaacgtggtcagggacgtgaactccatt
gagctgcgtttccagtcagcggtgttgtatgcagcacagcagagcaaagctcacactcgc
taccaggttcccccagactgccctccacttgtgcagaagggtgaatgccatgtcaacttt
gttcggaaggagcaatgttcctttagttgggactgggggccttcctttcctacccaggga
atctggaaagatgttagaattgaagcctataatatttgtcacctgaactacttcacattt
tccccaatatatgataagagtgcccaggagtggaatctggaaatagagtctacatttgat
gttgtcagctcaaagccagttggtggtcaagtgatcgtagccatccctaagttgcaaaca
caacagacatacagcattgaacttcaacctgggaaaaggattgttgagctatttgtgaac
attagcaagaatattactgtagaaacttggtggcctcatggacatggaaaccagactggg
tacaacatgactgttctttttgaactggatggaggcttaaatattgaaaaatcagctaag
gtttattttaggacagtggaacttatagaagagcctataaaagggtctcctggtttgagt
ttctatttcaaaattaatggatttcccatatttctaaaaggctcaaactggatcccagca
gattcattccaggaccgagtaacctctgagttgttacggctccttttacagtctgttgtg
gatgctaatatgaatactcttcgggtttggggaggaggaatttatgagcaggatgaattc
tatgaactctgtgatgaactaggaataatggtatggcaggattttatgtttgcctgtgcc
ctttatccaactgatcagggcttcctggattcagtgacagcagaagttgcctaccagatc
aagagactgaaatctcatccttctatcatcatatggagtggcaataatgaaaatgaggag
gcgctgatgatgaattggtatcatatcagtttcactgaccggccaatctacatcaaggac
tatgtgacactctatgtgaaaaacatcagagagctcgtactggcaggagacaagagtcgt
ccttttattacgtccagtcctacaaatggggctgaaactgttgcagaagcctgggtctct
caaaaccctaatagcaattattttggtgatgtacatttttatgactatatcagtgattgc
tggaactggaaagttttcccaaaagctcgatttgcatctgaatatggatatcagtcctgg
ccgtccttcagtacattagaaaaggtctcgtctacagaggactggtctttcaatagcaag
ttttcacttcatcgacaacatcacgaaggtggtaacaaacaaatgctttatcaggctgga
cttcatttcaaactcccccaaagcacagatccattacgcacatttaaagataccatctac
cttactcaggtgatgcaggcccagtgtgtcaaaacagaaactgaattctaccgccgtagt
cgcagcgagatagtggatcagcaagggcacacgatgggggcactttattggcagttgaat
gacatctggcaagctccttcctgggcttctcttgagtacggaggaaagtggaaaatgctt
cattactttgctcagaatttctttgctccactgttgccagtaggctttgagaatgaaaac
acgttctatatctatggtgtgtcagatcttcactcggattattcgatgacactcagtgtg
agagtccatacatggagctccctggagcccgtgtgctctcgtgtgactgaacgttttgtg
atgaaaggaggagaggctgtctgcctttatgaggagccagtgtctgaattgctgaggaga
tgtgggaattgcacacgggaaagctgtgtggtttccttttacctttcagctgaccatgaa
ctcctgagcccgaccaactaccacttcttgtcctcaccgaaggaggccgtggggctctgc
aaggcgcagatcactgccatcatctctcagcaaggtgacatatttgtttttgacctggag
acctcagctgtcgctccctttgtttggttggatgtaggaagcatcccagggagatttagt
gacaatggtttcctcatgactgagaagacacgaactatattattttacccttgggagccc
accagcaagaatgagttggagcaatcttttcatgtgacctccttaacagatatttactga

DBGET integrated database retrieval system