KEGG   Homo sapiens (human): 4245Help
Entry
4245              CDS       T01001                                 

Gene name
MGAT1, GLCNAC-TI, GLCT1, GLYT1, GNT-1, GNT-I, MGAT
Definition
mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (EC:2.4.1.101)
Orthology
K00726  
alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.101]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4245 (MGAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.101  alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     4245 (MGAT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  N-Glycan
   4245 (MGAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35
AA seq 445 aa AA seqDB search
MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPASLTREVIRLAQD
AEVELERQRGLLQQIGDALSSQRGRVPTAAPPAQPRVPVTPAPAVIPILVIACDRSTVRR
CLDKLLHYRPSAELFPIIVSQDCGHEETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQ
GYYKIARHYRWALGQVFRQFRFPAAVVVEDDLEVAPDFFEYFRATYPLLKADPSLWCVSA
WNDNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQG
RACIRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVHFTQLDLSYLQREAYDRDFLA
RVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIV
TFQFRGRRVHLAPPLTWEGYDPSWN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaagcagtctgcagggcttgtgctgtggggcgctatcctctttgtggcctgg
aatgccctgctgctcctcttcttctggacgcgcccagcacctggcaggccaccctcagtc
agcgctctcgatggcgaccccgccagcctcacccgggaagtgattcgcctggcccaagac
gccgaggtggagctggagcggcagcgtgggctgctgcagcagatcggggatgccctgtcg
agccagcgggggagggtgcccaccgcggcccctcccgcccagccgcgtgtgcctgtgacc
cccgcgccggcggtgattcccatcctggtcatcgcctgtgaccgcagcactgttcggcgc
tgcctggacaagctgctgcattatcggccctcggctgagctcttccccatcatcgttagc
caggactgcgggcacgaggagacggcccaggccatcgcctcctacggcagcgcggtcacg
cacatccggcagcccgacctgagcagcattgcggtgccgccggaccaccgcaagttccag
ggctactacaagatcgcgcgccactaccgctgggcgctgggccaggtcttccggcagttt
cgcttccccgcggccgtggtggtggaggatgacctggaggtggccccggacttcttcgag
tactttcgggccacctatccgctgctgaaggccgacccctccctgtggtgcgtctcggcc
tggaatgacaacggcaaggagcagatggtggacgccagcaggcctgagctgctctaccgc
accgactttttccctggcctgggctggctgctgttggccgagctctgggctgagctggag
cccaagtggccaaaggccttctgggacgactggatgcggcggccggagcagcggcagggg
cgggcctgcatacgccctgagatctcaagaacgatgacctttggccgcaagggtgtgagc
cacgggcagttctttgaccagcacctcaagtttatcaagctgaaccagcagtttgtgcac
ttcacccagctggacctgtcttacctgcagcgggaggcctatgaccgagatttcctcgcc
cgcgtctacggtgctccccagctgcaggtggagaaagtgaggaccaatgaccggaaggag
ctgggggaggtgcgggtgcagtatacgggcagggacagcttcaaggctttcgccaaggct
ctgggtgtcatggatgaccttaagtcgggggttccgagagctggctaccggggtattgtc
accttccagttccggggccgccgtgtccacctggcgcccccactgacgtgggagggctat
gatcctagctggaattag

DBGET integrated database retrieval system