KEGG   Homo sapiens (human): 11320Help
Entry
11320             CDS       T01001                                 

Gene name
MGAT4A, GNT-IV, GNT-IVA, GnT-4a
Definition
mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme A (EC:2.4.1.145)
Orthology
K00738  
alpha-1,3-mannosylglycoprotein beta-1,4-N-acetylglucosaminyltransferase A/B [EC:2.4.1.145]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    11320 (MGAT4A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.145  alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
     11320 (MGAT4A)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  N-Glycan
   11320 (MGAT4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q12
AA seq 423 aa AA seqDB search
MNYSITVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDIDYVHGV
VANLEKEFSKEISSGLVEVISPPESYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMY
AQEKGIYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMFQAPDLTLI
VEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQHVGLHSSL
SGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDY
ILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFR
IGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEQRVFSGWWQKSRDKAEGPQAP
LLF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaattacagtattacagtttcaatagtcatgggcattcccacagtgaagagagaagtt
aaatcttacctcatagaaactcttcattcccttattgataacctgtatcctgaagagaag
ttggactgtgttatagtagtcttcataggagagacagatattgattatgtacatggtgtt
gtagccaacctggagaaagaattttctaaagaaatcagttctggcttggtggaagtcata
tcaccccctgaaagctattatcctgacttgacaaacctaaaggagacatttggagactcc
aaagaaagagtaagatggagaacaaagcaaaacctagattactgttttctaatgatgtat
gctcaagaaaagggcatatattacattcagcttgaagatgatattattgtcaaacaaaat
tattttaataccataaaaaattttgcacttcaactttcttctgaggaatggatgattcta
gagttttcccagctgggcttcattggtaaaatgtttcaagcgccggatcttactctgatt
gtagaattcatattcatgttttacaaggagaaacccattgattggctcctggaccatatt
ctctgggtgaaagtctgcaaccctgaaaaagatgcaaaacattgtgatagacagaaagca
aatctgcgaattcgcttcagaccttcccttttccaacatgttggtctgcactcatcacta
tcaggaaaaatccaaaaactcacggataaagattatatgaaaccattacttcttaaaatc
catgtaaacccacctgcggaggtatctacttccttgaaggtctaccaagggcatacgctg
gagaaaacttacatgggagaggatttcttctgggctatcacaccgatagctggagactac
atcttgtttaaatttgataaaccagtcaatgtagaaagttatttgttccatagcggcaac
caagaacatcctggagatattctgctaaacacaactgtggaagttttgccttttaagagt
gaaggtttggaaataagcaaagaaaccaaagacaaacgattagaagatggctatttcaga
ataggaaaatttgagaatggtgttgcagaaggaatggtggatccaagtctcaatcccatt
tcagcctttcgactttcagttattcagaattctgctgtttgggccattcttaatgagcag
agagttttctcgggctggtggcagaagtcaagagacaaagcagaaggacctcaggcacca
ttgctgttttaa

DBGET integrated database retrieval system