KEGG   Homo sapiens (human): 11282Help
Entry
11282             CDS       T01001                                 

Gene name
MGAT4B, GNT-IV, GNT-IVB
Definition
mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme B (EC:2.4.1.145)
Orthology
K00738  
alpha-1,3-mannosylglycoprotein beta-1,4-N-acetylglucosaminyltransferase A/B [EC:2.4.1.145]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35
AA seq 548 aa AA seqDB search
MRLRNGTFLTLLLFCLCAFLSLSWYAALSGQKGDVVDVYQREFLALRDRLHAAEQESLKR
SKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLP
HLLAKESSLQPAVRVGQGRTGVSVVMGIPSVRREVHSYLTDTLHSLISELSPQEKEDSVI
VVLIAETDSQYTSAVTENIKALFPTEIHSGLLEVISPSPHFYPDFSRLRESFGDPKERVR
WRTKQNLDYCFLMMYAQSKGIYYVQLEDDIVAKPNYLSTMKNFALQQPSEDWMILEFSQL
GFIGKMFKSLDLSLIVEFILMFYRDKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIR
FKPSLFQHVGTHSSLAGKIQKLKDKDFGKQALRKEHVNPPAEVSTSLKTYQHFTLEKAYL
REDFFWAFTPAAGDFIRFRFFQPLRLERFFFRSGNIEHPEDKLFNTSVEVLPFDNPQSDK
EALQEGRTATLRYPRSPDGYLQIGSFYKGVAEGEVDPAFGPLEALRLSIQTDSPVWVILS
EIFLKKAD
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaggctccgcaatggcaccttcctgacgctgctgctcttctgcctgtgcgccttcctc
tcgctgtcctggtacgcggcactcagcggccagaaaggcgacgttgtggacgtttaccag
cgggagttcctggcgctgcgcgatcggttgcacgcagctgagcaggagagcctcaagcgc
tccaaggagctcaacctggtgctggacgagatcaagagggccgtgtcagaaaggcaggcg
ctgcgagacggagacggcaatcgcacctggggccgcctaacagaggacccccgattgaag
ccgtggaacggctcacaccggcacgtgctgcacctgcccaccgtcttccatcacctgcca
cacctgctggccaaggagagcagtctgcagcccgcggtgcgcgtgggccagggccgcacc
ggagtgtcggtggtgatgggcatcccgagcgtgcggcgcgaggtgcactcgtacctgact
gacactctgcactcgctcatctccgagctgagcccgcaggagaaggaggactcggtcatc
gtggtgctgatcgccgagactgactcacagtacacttcggcagtgacagagaacatcaag
gccttgttccccacggagatccattctgggctcctggaggtcatctcaccctccccccac
ttctaccctgacttctcccgcctccgagagtcctttggggaccccaaggagagagtcagg
tggaggaccaaacagaacctcgattactgcttcctcatgatgtacgcgcagtccaaaggc
atctactacgtgcagctggaggatgacatcgtggccaagcccaactacctgagcaccatg
aagaactttgcactgcagcagccttcagaggactggatgatcctggagttctcccagctg
ggcttcattggtaagatgttcaagtcgctggacctgagcctgattgtagagttcattctc
atgttctaccgggacaagcccatcgactggctcctggaccatattctgtgggtgaaagtc
tgcaaccccgagaaggatgcgaagcactgtgaccggcagaaagccaacctgcggatccgc
ttcaaaccgtccctcttccagcacgtgggcactcactcctcgctggctggcaagatccag
aaactgaaggacaaagactttggaaagcaggcgctgcggaaggagcatgtgaacccgcca
gcagaggtgagcacgagcctgaagacataccagcacttcaccctggagaaagcctacctg
cgcgaggacttcttctgggccttcacccctgccgcgggggacttcatccgcttccgcttc
ttccaacctctaagactggagcggttcttcttccgcagtgggaacatcgagcacccggag
gacaagctcttcaacacgtctgtggaggtgctgcccttcgacaaccctcagtcagacaag
gaggccctgcaggagggccgcaccgccaccctccggtaccctcggagccccgacggctac
ctccagatcggctccttctacaagggagtggcagagggagaggtggacccagccttcggc
cctctggaagcactgcgcctctcgatccagacggactcccctgtgtgggtgattctgagc
gagatcttcctgaaaaaggccgactaa

DBGET integrated database retrieval system