KEGG   Homo sapiens (human): 4249Help
Entry
4249              CDS       T01001                                 

Gene name
MGAT5, GNT-V, GNT-VA
Definition
mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase (EC:2.4.1.155)
Orthology
K00744  
alpha-1,3(6)-mannosylglycoprotein beta-1,6-N-acetyl-glucosaminyltransferase [EC:2.4.1.155]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q21.3
AA seq 741 aa AA seqDB search
MALFTPWKLSSQKLGFFLVTFGFIWGMMLLHFTIQQRTQPESSSMLREQILDLSKRYIKA
LAEENRNVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNLVVNGTGTNSTNST
TAVPSLVALEKINVADIINGAQEKCVLPPMDGYPHCEGKIKWMKDMWRSDPCYADYGVDG
STCSFFIYLSEVENWCPHLPWRAKNPYEEADHNSLAEIRTDFNILYSMMKKHEEFRWMRL
RIRRMADAWIQAIKSLAEKQNLEKRKRKKVLVHLGLLTKESGFKIAETAFSGGPLGELVQ
WSDLITSLYLLGHDIRISASLAELKEIMKKVVGNRSGCPTVGDRIVELIYIDIVGLAQFK
KTLGPSWVHYQCMLRVLDSFGTEPEFNHANYAQSKGHKTPWGKWNLNPQQFYTMFPHTPD
NSFLGFVVEQHLNSSDIHHINEIKRQNQSLVYGKVDSFWKNKKIYLDIIHTYMEVHATVY
GSSTKNIPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFN
PPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVDLNNQEEVEDAVKAILNQKIE
PYMPYEFTCEGMLQRINAFIEKQDFCHGQVMWPPLSALQVKLAEPGQSCKQVCQESQLIC
EPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRH
QRVCPCRDFIKGQVALCKDCL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggctctcttcactccgtggaagttgtcctctcagaagctgggctttttcctggtgact
tttggcttcatttggggtatgatgcttctgcactttaccatccagcagcgaactcagcct
gaaagcagctccatgctgcgcgagcagatcctggacctcagcaaaaggtacatcaaggca
ctggcagaagaaaacaggaatgtggtggatgggccatacgctggagtcatgacagcttat
gatctgaagaaaacccttgctgtgttattagataacattttgcagcgcattggcaagttg
gagtcgaaggtggacaatcttgttgtcaatggcaccggaacaaactcaaccaactccact
acagctgttcccagcttggttgcacttgagaaaattaatgtggcagatatcattaacgga
gctcaagaaaaatgtgtattgcctcctatggacggctaccctcactgtgagggaaagatc
aagtggatgaaagacatgtggcgttcagatccctgctacgcagactatggagtggatgga
tccacctgctctttttttatttacctcagtgaggttgaaaattggtgtcctcatttacct
tggagagcaaaaaatccctacgaagaagctgatcataattcattggcggaaattcgtaca
gattttaatattctctacagtatgatgaaaaagcatgaagaattccggtggatgagacta
cggatccggcgaatggctgacgcatggatccaagcaatcaagtccctggcagaaaagcag
aaccttgaaaagagaaagcggaagaaagtcctcgttcacctgggactcctgaccaaggaa
tctggatttaagattgcagagacagctttcagtggtggccctcttggtgaattagttcaa
tggagtgatttaattacatctctgtacttactgggccatgacattaggatttcagcttca
ctggctgagctcaaggaaatcatgaagaaggttgtaggaaaccgatctggctgcccaact
gtaggagacagaattgttgagctcatttacattgatattgtaggacttgctcaattcaag
aaaactcttggaccatcctgggttcattaccagtgcatgctccgagtccttgattcattt
ggtactgaacccgaatttaatcatgcaaattatgcccaatcgaaaggccacaagacccct
tggggaaaatggaatctgaaccctcagcagttttataccatgttccctcataccccagac
aacagctttctggggtttgtggttgagcagcacctgaactccagtgatatccaccacatt
aatgaaatcaaaaggcagaaccagtcccttgtgtatggcaaagtggatagcttctggaag
aataagaagatctacttggacattattcacacatacatggaagtgcatgcaactgtttat
ggctccagcacaaagaatattcccagttacgtgaaaaaccatggtatcctcagtggacgg
gacctgcagttccttcttcgagaaaccaagttgtttgttggacttgggttcccttacgag
ggcccagctcccctggaagctatcgcaaatggatgtgcttttctgaatcccaagttcaac
ccacccaaaagcagcaaaaacacagactttttcattggcaagccaactctgagagagctg
acatcccagcatccttacgctgaagttttcatcgggcggccacatgtgtggactgttgac
ctcaacaatcaggaggaagtagaggatgcagtgaaagcaattttaaatcagaagattgag
ccatacatgccatatgaatttacgtgcgaggggatgctacagagaatcaatgctttcatt
gaaaaacaggacttctgccatgggcaagtgatgtggccacccctcagcgccctacaggtc
aagcttgctgagcccgggcagtcctgcaagcaggtgtgccaggagagccagctcatctgc
gagccttctttcttccagcacctcaacaaggacaaggacatgctgaagtacaaggtgacc
tgccaaagctcagagctggccaaggacatcctggtgccctcctttgaccctaagaataag
cactgtgtgtttcaaggtgacctcctgctcttcagctgtgcaggcgcccaccccaggcac
cagagggtctgcccctgccgggacttcatcaagggccaggtggctctctgcaaagactgc
ctatag

DBGET integrated database retrieval system