KEGG   Homo sapiens (human): 146664Help
Entry
146664            CDS       T01001                                 

Gene name
MGAT5B, GnT-IX, GnT-VB
Definition
mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, isozyme B (EC:2.4.1.155)
Orthology
K09661  
mannosyl alpha-1,6-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, isozyme B [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    146664 (MGAT5B)
   00514 Other types of O-glycan biosynthesis
    146664 (MGAT5B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     146664 (MGAT5B)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Wide specificity
   146664 (MGAT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.2
AA seq 792 aa AA seqDB search
MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTE
VMGGPESRGVLRKMSDLLELMVKRMDALARLENSSELHRAGGDLHFPADRMPPGAGLMER
IQAIAQNVSDIAVKVDQILRHSLLLHSKVSEGRRDQCEAPSDPKFPDCSGKVEWMRARWT
SDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAVFRSNLSHL
LDLMGSGKESLIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDV
FSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQSNLGVPPGRGSCPLTMPLP
FDLIYTDYHGLQQMKRHMGLSFKKYRCRIRVIDTFGTEPAYNHEEYATLHGYRTNWGYWN
LNPKQFMTMFPHTPDNSFMGFVSEELNETEKRLIKGGKASNMAVVYGKEASIWKLQGKEK
FLGILNKYMEIHGTVYYESQRPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGP
APLEAIANGCIFLQSRFSPPHSSLNHEFFRGKPTSREVFSQHPYAENFIGKPHVWTVDYN
NSEEFEAAIKAIMRTQVDPYLPYEYTCEGMLERIHAYIQHQDFCRAPDPALPEAHAPQSP
FVLAPNATHLEWARNTSLAPGAWPPAHALRAWLAVPGRACTDTCLDHGLICEPSFFPFLN
SQDAFLKLQVPCDSTESEMNHLYPAFAQPGQECYLQKEPLLFSCAGSNTKYRRLCPCRDF
RKGQVALCQGCL
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgtcaaccccgatgggaagataatggtcagaagatgcctggtcaccctgaga
ccctttcggctttttgtcctgggcatcggcttcttcactctctgcttcctgatgacgtct
ctgggaggccagttctcggcccggcgcctgggggactcgccattcaccatccgcacagaa
gtgatggggggccccgagtcccgcggcgtcctgcgcaagatgagcgacctgctggagctg
atggtgaagcgcatggacgcactggccaggctggagaacagcagtgagctgcaccgggcc
ggcggcgacctgcactttcccgcagacaggatgccccctggggccggcctcatggagcgg
atccaggctattgcccagaacgtctccgacatcgctgtgaaggtggaccagatcctgcgc
cacagtctgctcctgcacagcaaggtgtcagaaggccggcgggaccagtgtgaggcaccc
agtgaccccaagttccctgactgctcagggaaggtggagtggatgcgtgcccgctggacc
tctgacccctgctacgccttctttggggtggacggcaccgagtgctccttcctcatctac
ctcagtgaggtcgagtggttctgccccccgctgccctggaggaaccagacggctgcccag
agggcacccaagcccctccccaaagtccaggcagttttccgaagcaacctgtcccacctt
ctggacctgatgggcagcgggaaggagtccctgatcttcatgaagaagcggaccaagagg
ctcacagcccagtgggcgctggctgcccagcgcctggcacagaagctgggggccacccag
agggaccagaagcagatcctggtccacatcggcttcctgacggaggagtccggggacgtg
ttcagccctcgggtcctgaagggcgggcccctaggggagatggtgcagtgggcggacatt
ctgactgcactctatgtcctgggccatggcctgcgggtcacagtctccctgaaggagctg
cagagtaacttaggggtaccgccaggccggggaagctgcccgctcaccatgcccctgccc
ttcgacctcatctacaccgactaccacggcctgcagcagatgaagcggcacatgggactc
tccttcaagaagtaccggtgccgaatcagggtcatcgacaccttcgggacggaacctgcg
tacaaccacgaggagtacgccacgctgcacggctaccggaccaactggggctactggaac
ctcaaccccaagcagttcatgaccatgtttcctcatacccccgacaactccttcatgggc
ttcgtgtccgaggagctcaacgagacggagaagcggctcatcaaaggcggcaaggccagc
aacatggccgtggtgtacggcaaggaggcgagcatctggaagctccaggggaaggagaag
ttcctgggcatcctgaacaaatacatggagatccatggcaccgtgtactacgagagccag
cggccccccgaggtgccagcctttgtgaagaaccacggcctcttaccgcagcctgagttt
cagcagctgctgcgcaaggccaaactcttcatcgggtttggcttcccctacgagggcccc
gcccccctggaggccatcgccaatggttgcatcttcctgcagtcccgcttcagcccgccc
cacagctccctcaaccacgagttcttccgaggcaagcccacctccagagaggtgttctcc
cagcatccctacgcggagaacttcatcggcaagccccacgtgtggacagtcgactacaac
aactcagaggagtttgaagcagccatcaaggccattatgagaactcaggtagacccctac
ctaccctacgagtacacctgcgaggggatgctggagcggatccacgcctacatccagcac
caggacttctgcagagctccagaccctgccctaccagaggcccacgccccgcagagcccc
tttgtcctggcccccaatgccacccacctcgagtgggctcggaacaccagcttggctcct
ggggcctggccccccgcgcacgccctgcgggcctggctggccgtgcctgggagggcctgc
accgacacctgcctggaccacgggctaatctgtgagccctccttcttccccttcctgaac
agccaggacgccttcctcaagctgcaggtgccctgtgacagcaccgagtcggagatgaac
cacctgtacccggcgttcgcccagcctggccaggagtgctacctgcagaaggagcctctg
ctcttcagctgcgccggctccaacaccaagtaccgccggctctgcccctgccgcgacttc
cgcaagggccaggtggccttgtgccagggctgtctgtga

DBGET integrated database retrieval system