KEGG   Homo sapiens (human): 4758Help
Entry
4758              CDS       T01001                                 

Gene name
NEU1, NANH, NEU, SIAL1
Definition
sialidase 1 (lysosomal sialidase) (EC:3.2.1.18)
Orthology
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Other glycan degradation
Sphingolipid metabolism
Lysosome
Disease
H00142  
Sialidosis
H00276  
Galactosialidosis
H00422  
Glycoproteinoses
H00810  
Progressive myoclonic epilepsy (PME/ EPM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    4758 (NEU1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4758 (NEU1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    4758 (NEU1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     4758 (NEU1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 415 aa AA seqDB search
MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTM
EQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGST
WSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVS
WSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASW
RYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACD
TLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKET
VQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgactggggagcgacccagcacggcgctcccggacagacgctgggggccgcggattctg
ggcttctggggaggctgtagggtttgggtgtttgccgcgatcttcctgctgctgtctctg
gcagcctcctggtccaaggctgagaacgacttcggtctggtgcagccgctggtgaccatg
gagcaactgctgtgggtgagcgggagacagatcggctcagtggacaccttccgcatcccg
ctcatcacagccactccgcggggcactcttctcgcctttgctgaggcgaggaaaatgtcc
tcatccgatgagggggccaagttcatcgccctgcggaggtccatggaccagggcagcaca
tggtctcctacagcgttcattgtcaatgatggggatgtccccgatgggctgaaccttggg
gcagtagtgagcgatgttgagacaggagtagtatttcttttctactccctttgtgctcac
aaggccggctgccaggtggcctctaccatgttggtatggagcaaggatgatggtgtttcc
tggagcacaccccggaatctctccctggatattggcactgaagtgtttgcccctggaccg
ggctctggtattcagaaacagcgggagccacggaagggccgcctcatcgtgtgtggccat
gggacgctggagcgggacggagtcttctgtctcctcagcgatgatcatggtgcctcctgg
cgctacggaagtggggtcagcggcatcccctacggtcagcccaagcaggaaaatgatttc
aatcctgatgaatgccagccctatgagctcccagatggctcagtcgtcatcaatgcccga
aaccagaacaactaccactgccactgccgaattgtcctccgcagctatgatgcctgtgat
acactaaggccccgtgatgtgaccttcgaccctgagctcgtggaccctgtggtagctgca
ggagctgtagtcaccagctccggcattgtcttcttctccaacccagcacatccagagttc
cgagtgaacctgaccctgcgatggagcttcagcaatggtacctcatggcggaaagagaca
gtccagctatggccaggccccagtggctattcatccctggcaaccctggagggcagcatg
gatggagaggagcaggccccccagctctacgtcctgtatgagaaaggccggaaccactac
acagagagcatctccgtggccaaaatcagtgtctatgggacactctga

DBGET integrated database retrieval system