KEGG   Homo sapiens (human): 8473Help
Entry
8473              CDS       T01001                                 

Gene name
OGT, HRNT1, O-GLCNAC
Definition
O-linked N-acetylglucosamine (GlcNAc) transferase (EC:2.4.1.255)
Orthology
K09667  
protein O-GlcNAc transferase [EC:2.4.1.255]
Organism
hsa  Homo sapiens (human)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    8473 (OGT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     8473 (OGT)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type (GlcNAc b1- Ser/Thr)
   8473 (OGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq13
AA seq 1046 aa AA seqDB search
MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLL
LSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKP
DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACY
LKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARI
FDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLA
NALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF
AAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTR
AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWT
DYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHK
PPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTN
FRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQA
MWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAV
IDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMN
TIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPED
AIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRI
IFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQL
TCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLY
LQMWEHYAAGNKPDHMIKPVEVTESA
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttccgtgggcaacgtggccgacagcacagaaccaacgaaacgtatgctttcc
ttccaagggttagctgagttggcacatcgagaatatcaggcaggagattttgaggcagct
gagagacactgcatgcagctctggagacaagagccagacaatactggtgtgcttttatta
ctttcatctatacacttccagtgtcgaaggctggacagatctgctcactttagcactctg
gcaattaaacagaacccccttctggcagaagcttattcgaatttggggaatgtgtacaag
gaaagagggcagttgcaggaggcaattgagcattatcgacatgcattgcgtctcaaacct
gatttcatcgatggttatattaacctggcagccgccttggtagcagcgggtgacatggaa
ggggcagtacaagcttacgtctctgctcttcagtacaatcctgatttgtactgtgttcgc
agtgacctggggaacctgctcaaagccctgggtcgcttggaagaagccaaggcatgttat
ttgaaagcaattgagacgcaaccgaactttgcagtagcttggagtaatcttggctgtgtt
ttcaatgcacaaggggaaatttggcttgcaattcatcactttgaaaaggctgtcaccctt
gacccaaactttctggatgcttatatcaatttaggaaatgtcttgaaagaggcacgcatt
tttgacagagctgtggcagcttatcttcgtgccctaagtttgagtccaaatcacgcagtg
gtgcacggcaacctggcttgtgtatactatgagcaaggcctgatagatctggcaatagac
acctacaggcgggctatcgaactacaaccacatttccctgatgcttactgcaacctagcc
aatgctctcaaagagaagggcagtgttgctgaagcagaagattgttataatacagctctc
cgtctgtgtcccacccatgcagactctctgaataacctagccaatatcaaacgagaacag
ggaaacattgaagaggcagttcgcttgtatcgtaaagcattagaagtcttcccagagttt
gctgctgcccattcaaatttagcaagtgtactgcagcagcagggaaaactgcaggaagct
ctgatgcattataaggaggctattcgaatcagtcctacctttgctgatgcctactctaat
atgggaaacactctaaaggagatgcaggatgttcagggagccttgcagtgttatacgcgt
gccatccaaattaatcctgcatttgcagatgcacatagcaatctggcttccattcataag
gattcagggaatattccagaagccatagcttcttaccgcacggctctgaaacttaagcct
gattttcctgatgcttattgtaacttggctcattgcctgcagattgtctgtgattggaca
gactatgatgagcgaatgaagaagttggtcagtattgtggctgaccagttagagaagaat
aggttgccttctgtgcatcctcatcatagtatgctatatcctctttctcatggcttcagg
aaggctattgctgagaggcacggcaacctgtgcttagataagattaatgttcttcataaa
ccaccatatgaacatccaaaagacttgaagctcagtgatggtcggctgcgtgtaggatat
gtgagttccgactttgggaatcatcctacttctcaccttatgcagtctattccaggcatg
cacaatcctgataaatttgaggtgttctgttatgccctgagcccagacgatggcacaaac
ttccgagtgaaggtgatggcagaagccaatcatttcattgatctttctcagattccatgc
aatggaaaagcagctgatcgcatccatcaggatggaattcatatccttgtaaatatgaat
ggctatactaagggcgctcgaaatgagctttttgctctcaggccagctcctattcaggca
atgtggctgggataccctgggacgagtggtgcgcttttcatggattatattatcactgat
caggaaacttcgccagctgaagttgctgagcagtattccgagaaattggcttatatgccc
cacactttttttattggtgatcatgctaatatgttccctcacctgaagaaaaaagcagtc
atcgattttaagtccaatgggcacatttatgacaatcggatagttctgaatggcatcgac
ctcaaagcatttcttgatagtctaccagatgtgaaaattgtcaagatgaagtgtcctgat
ggaggagacaatgcagatagcagtaacacagctcttaatatgcctgttattcctatgaat
actattgcagaagcagttattgaaatgattaaccgaggacagattcaaataacaattaat
ggattcagtattagcaatggactggcaactactcagatcaacaataaggctgcaactgga
gaggaggttccccgtaccattattgtaaccacccgttctcagtacgggttaccagaagat
gccatcgtatactgtaactttaatcagttgtataaaattgacccttctactttgcagatg
tgggcaaacattctgaagcgtgttcccaatagtgtactctggctgttgcgttttccagca
gtaggagaacctaatattcaacagtatgcacaaaacatgggcctgccccagaaccgtatc
attttttcacctgttgctcctaaagaggaacacgtcaggagaggccagctggctgatgtc
tgcttggacactccactctgtaatgggcacaccacagggatggatgtcctctgggcaggg
acccccatggtgactatgccaggagagactcttgcttctcgagttgcagcatcccagctc
acttgcttaggttgtcttgagcttattgctaaaaacagacaagaatatgaagacatagct
gtgaagctgggaactgatctagaatacctgaagaaagttcgtggcaaagtctggaagcaa
agaatatctagccctctgttcaacaccaaacaatacacaatggaactagagcggctctat
ctacagatgtgggagcattatgcagctggcaacaaacctgaccacatgattaagcctgtt
gaagtcactgagtcagcataa

DBGET integrated database retrieval system