KEGG   Homo sapiens (human): 5279Help
Entry
5279              CDS       T01001                                 

Gene name
PIGC, GPI2
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class C
  KO
K03859  
phosphatidylinositol glycan, class C
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    5279 (PIGC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q92535(Tbio)
UniProt: 
Position
1q24.3
AA seq 297 aa AA seqDB search
MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQ
QLCSVCVFVVIWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADL
KSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLN
MAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTLLFAFSAV
GGLLSISAVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtatgctcaacctgtgactaacaccaaggaggtcaagtggcagaaggtcttgtatgag
cgacagccctttcctgataactatgtggaccggcgattcctggaagagctccggaaaaac
atccatgctcggaaataccaatattgggctgtggtatttgagtccagtgtggtgatccag
cagctgtgcagtgtttgtgtttttgtggttatctggtggtatatggatgagggtcttctg
gccccccattggcttttagggactggtctggcttcttcactgattgggtatgttttgttt
gatctcattgatggaggtgaagggcggaagaagagtgggcagacccggtgggctgacctg
aagagtgccctagtcttcattactttcacttatgggttttcaccagtgctgaagaccctt
acagagtctgtcagcactgacaccatctatgccatgtcagtcttcatgctgttaggccat
ctcatcttttttgactatggtgccaatgctgccattgtatccagcacactatccttgaac
atggccatctttgcttctgtatgcttggcatcacgtcttccccggtccctgcatgccttc
atcatggtgacatttgccattcagatttttgccctgtggcccatgttgcagaagaaacta
aaggcatgtactccccggagctatgtgggggtcacactgctttttgcattttcagccgtg
ggaggcctactgtccattagtgctgtgggagccgtactctttgcccttctgctgatgtct
atctcatgtctgtgtccattctacctcattcgcttgcagctttttaaagaaaacattcat
gggccttgggatgaagctgaaatcaaggaagacttgtccaggttcctcagttaa

DBGET integrated database retrieval system