KEGG   Homo sapiens (human): 5283Help
Entry
5283              CDS       T01001                                 

Gene name
PIGH, GPI-H
Definition
phosphatidylinositol glycan anchor biosynthesis, class H (EC:2.4.1.198)
Orthology
K03858  
phosphatidylinositol glycan, class H
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosylphosphatidylinositol(GPI)-anchor biosynthesis [PATH:hsa00563]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q24.1
AA seq 188 aa AA seqDB search
MEDERSFSDICGGRLALQRRYYSPSCREFCLSCPRLSLRSLTAVTCTVWLAAYGLFTLCE
NSMILSAAIFITLLGLLGYLHFVKIDQETLLIIDSLGIQMTSSYASGKESTTFIEMGKVK
DIVINEAIYMQKVIYYLCILLKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAH
QKATSTSP
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgagcggagcttttcggatatctgcggcggccgcctggcgctgcagcgccgc
tactactccccgtcctgccgggaattctgcctcagctgccctcggctctcgctgcgttcg
ctcaccgctgtcacctgcacggtgtggctggcggcctacggactcttcaccctctgcgag
aacagcatgatcctctctgctgccatcttcatcaccctcttaggtctgcttggttatctc
cattttgtgaagattgatcaggagactctgttaatcattgattcccttggcattcagatg
acttcatcttatgcttcaggcaaagaaagcactaccttcatagaaatgggcaaggtcaag
gatattgtcatcaatgaggccatttacatgcagaaggtgatttactacctctgcatctta
ttgaaagatccagtggaaccacatgggatatcccaagtagtacccgtcttccagagtgcc
aagccccggctggactgcttgattgaagtatacaggagctgccaggagatcctggcacac
cagaaagccacatcaacaagcccatga

DBGET integrated database retrieval system