KEGG   Homo sapiens (human): 51227Help
Entry
51227             CDS       T01001                                 

Gene name
PIGP, DCRC, DCRC-S, DSCR5, DSRC
Definition
phosphatidylinositol glycan anchor biosynthesis, class P (EC:2.4.1.198)
Orthology
K03861  
phosphatidylinositol glycan, class P
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    51227 (PIGP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.2
AA seq 158 aa AA seqDB search
MVPRSTSLTLIVFLFHRLSKAPGKMVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFI
PESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAK
NQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggtgccacggagcacatcgctgacgctgattgtgttccttttccacagattgtctaaa
gccccaggaaaaatggtggaaaattcaccgtcgccattgccagaaagagcgatttatggc
tttgttcttttcttaagctcccaatttggcttcatactttacctcgtgtgggcctttatt
cctgaatcttggctaaactctttaggtttaacctattggcctcaaaaatattgggcagtt
gcattacctgtctacctccttattgctatagtaattggctacgtgctcttgtttgggatt
aacatgatgagtacctctccactcgactccatccatacaatcacagataactatgcaaaa
aatcaacagcagaagaaataccaagaggaggccattccagccttaagagatatttctatt
agtgaagtaaaccaaatgttctttcttgcagccaaagaactttacaccaaaaactga

DBGET integrated database retrieval system