KEGG   Homo sapiens (human): 9091Help
Entry
9091              CDS       T01001                                 

Gene name
PIGQ, GPI1, c407A10.1
Definition
phosphatidylinositol glycan anchor biosynthesis, class Q (EC:2.4.1.198)
Orthology
K03860  
phosphatidylinositol glycan, class Q
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    9091 (PIGQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 581 aa AA seqDB search
MVLKAFFPTCCVSTDSGLLVGRWVPEQSSAVVLAVLHFPFIPIQVKQLLAQVRQASQVGV
AVLGTWCHCRQEPEESLGRFLESLGAVFPHEPWLRLCRERGGTFWSCEATHRQAPTAPGA
PGEDQVMLIFYDQRQVLLSQLHLPTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDR
FDEGPVRLSHWQSEGVEASILAELARRASGPICLLLASLLSLVSAVSACRVFKLWPLSFL
GSKLSTCEQLRHRLEHLTLIFSTRKAENPAQLMRKANTVASVLLDVALGLMLLSWLHGRS
RIGHLADALVPVADHVAEELQHLLQWLMGAPAGLKMNRALDQVLGRFFLYHIHLWISYIH
LMSPFVEHILWHVGLSACLGLTVALSLLSDIIALLTFHIYCFYVYGARLYCLKIHGLSSL
WRLFRGKKWNVLRQRVDSCSYDLDQLFIGTLLFTILLFLLPTTALYYLVFTLLRLLVVAV
QGLIHLLVDLINSLPLYSLGLRLCRPYRLAAGVKFRVLRHEAGRPLRLLMQINPLPYSRV
VHTYRLPSCGCHPKHSWGALCRKLFLGELIYPWRQRGDKQD
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcaaggccttcttccccacgtgctgcgtctcgacggacagcgggctgctggtg
ggacggtgggtgccggagcagagcagcgccgtggtcctggcggtcctgcactttcccttc
atccccatccaggtcaagcagctcctggcccaggtgcggcaggccagccaggtgggcgtg
gccgtgctgggcacctggtgccactgccggcaggagcccgaggagagcctgggccgcttc
ctggagagcctgggtgctgtcttcccccatgagccctggctgcggctgtgccgggagaga
ggcggcacgttctggagctgcgaggccacccaccggcaagcgcccactgcccccggtgcc
cctggtgaggaccaggtcatgctcatcttctatgaccagcgccaggtgttgctgtcacag
ctacacctgcccaccgtcctgcccgaccgccaggctggagccaccactgccagcacgggg
ggcctggctgccgtcttcgacacggtagcacgcagtgaggtgctcttccgcagtgaccgc
tttgatgagggccccgtgcggctgagccactggcagtcggagggcgtggaggccagcatc
ctcgcggagctggccaggcgagcctcgggacccatttgcctgctgttggccagcctgctg
tcgctggtctcagctgtcagtgcctgccgagtgttcaagctctggcccctgtccttcctc
gggagcaaactctccacgtgcgaacagctccggcaccggctggagcacctcacgctaatc
ttcagtacacggaaggcggagaaccctgcccagctgatgaggaaggccaacacggtggcc
tctgtgctgctggacgtggccctgggcctcatgctgctgtcctggctccacgggagaagc
cgcatcgggcatctggccgacgccctcgttcctgtggctgaccacgtggccgaggagctc
cagcatctgctgcagtggctgatgggtgctcccgccgggctcaagatgaaccgtgcactg
gaccaggtgctgggccgcttcttcctctaccacatccacctgtggatcagctacatccac
ctcatgtcccccttcgtggagcacatcctttggcacgtgggcctctcggcctgcctgggc
ctgacggtggccctgtccctcctctcggacattatcgccctcctcaccttccacatctac
tgcttttacgtctatggagccaggctgtactgcctgaagatccatggcctgtcctcactg
tggcgtctgttccgggggaagaagtggaacgttctgcgccagcgcgtggactcctgttcc
tatgacctggaccagctgttcatcgggactctgctcttcaccatcctgctcttcctcctg
cctaccacagccctgtactacctggtgttcaccctgctccggctcctggtggtcgccgtg
cagggcctgatccatctgctcgtggacctcatcaactccctgccgctgtactcactgggt
cttcggctctgccggccctacaggctggcggctggcgtgaagttccgtgtcctccggcac
gaggccggcaggcccctccgcctcctgatgcagataaacccactgccctacagccgcgtg
gtgcacacctaccgcctccccagctgtggctgccaccccaagcactcctggggcgccctg
tgccgcaagctgttccttggggagctcatctacccctggaggcagagaggggacaagcag
gactga

DBGET integrated database retrieval system