KEGG   Homo sapiens (human): 54965Help
Entry
54965             CDS       T01001                                 

Gene name
PIGX, PIG-X
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class X
  KO
K07541  
phosphatidylinositol glycan, class X
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    54965 (PIGX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q29
AA seq 258 aa AA seqDB search
MAARVAAVRAAAWLLLGAATGLTRGPAAAFTAARSDAGIRAMCSEIILRQEVLKDGFHRD
LLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPN
YLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFP
ILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITI
LCSTLILVAVFKYGHFSL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ctggcggctcgggtggcggcggttcgggcggccgcctggctgctcctcggggcggcgacc
gggctcacgcgcgggcccgccgcggccttcaccgccgcgcgctctgacgccggcataagg
gccatgtgttctgaaattattttgaggcaagaagttttgaaagatggtttccacagagac
cttttaatcaaagtgaagtttggggaaagcattgaggacttgcacacctgccgtctctta
attaaacaggacattcctgcaggactttatgtggatccgtatgagttggcttcattacga
gagagaaacataacagaggcagtgatggtttcagaaaattttgatatagaggcccctaac
tatttgtccaaggagtctgaagttctcatttatgccagacgagattcacagtgcattgac
tgttttcaagcctttttgcctgtgcactgccgctatcatcggccgcacagtgaagatgga
gaagcctcgattgtggtcaataacccagatttgttgatgttttgtgaccaagagttcccg
attttgaaatgctgggctcactcagaagtggcagccccttgtgctttggagaatgaggat
atctgccaatggaacaagatgaagtataaatcagtatataagaatgtgattctacaagtt
ccagtgggactgactgtacatacctctctagtatgttctgtgactctgctcattacaatc
ctgtgctctacattgatccttgtagcagttttcaaatatggccatttttccctataa

DBGET integrated database retrieval system