KEGG   Homo sapiens (human): 84992Help
Entry
84992             CDS       T01001                                 

Gene name
PIGY, HPMRS6, PIG-Y
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class Y
  KO
K11001  phosphatidylinositol glycan anchor biosynthesis, class Y
Organism
hsa  Homo sapiens (human)
Pathway
hsa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
hsa01100  Metabolic pathways
Disease
H01488  Hyperphosphatasia with mental retardation syndrome (HPMPS)
H01489  Inherited glycosylphosphatidylinositol (GPI) deficiencies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    84992 (PIGY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIG-Y FLILHELTA
Motif
Other DBs
NCBI-GeneID: 84992
NCBI-ProteinID: NP_001036081
OMIM: 610662
HGNC: 28213
Ensembl: ENSG00000255072
Vega: OTTHUMG00000166563
Pharos: Q3MUY2(Tdark)
UniProt: Q3MUY2
Position
4q22.1
AA seq 71 aa AA seqDB search
MFLSLPTLTVLIPLVSLAGLFYSASVEENFPQGCTSTASLCFYSLLLPITIPVYVFFHLW
TWMGIKLFRHN
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgtctcttcctacgttgactgttcttattccactggtttctttagcaggactg
ttctactcagcctctgtggaagaaaacttcccacagggctgcactagcacagccagcctt
tgcttttacagcctgctcttgcctattaccataccagtgtatgtattcttccacctttgg
acttggatgggtattaaactcttcaggcataattga

DBGET integrated database retrieval system