KEGG   Homo sapiens (human): 84992Help
Entry
84992             CDS       T01001                                 

Gene name
PIGY, PIG-Y
Definition
phosphatidylinositol glycan anchor biosynthesis, class Y
Orthology
K11001  
phosphatidylinositol glycan anchor biosynthesis, class Y
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosylphosphatidylinositol(GPI)-anchor biosynthesis [PATH:hsa00563]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
4q22.1
AA seq 71 aa AA seqDB search
MFLSLPTLTVLIPLVSLAGLFYSASVEENFPQGCTSTASLCFYSLLLPITIPVYVFFHLW
TWMGIKLFRHN
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgtctcttcctacgttgactgttcttattccactggtttctttagcaggactg
ttctactcagcctctgtggaagaaaacttcccacagggctgcactagcacagccagcctt
tgcttttacagcctgctcttgcctattaccataccagtgtatgtattcttccacctttgg
acttggatgggtattaaactcttcaggcataattga

DBGET integrated database retrieval system