KEGG   Homo sapiens (human): 80235Help
Entry
80235             CDS       T01001                                 

Gene name
PIGZ, GPI-MT-IV, PIG-Z, SMP3
Definition
phosphatidylinositol glycan anchor biosynthesis, class Z
Orthology
K08098  
phosphatidylinositol glycan, class Z [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    80235 (PIGZ)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     80235 (PIGZ)
Glycosyltransferases [BR:hsa01003]
 GPI-anchor biosynthesis
  Core oligosaccharide
   80235 (PIGZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q29
AA seq 579 aa AA seqDB search
MQICGSSVASVAAGTSFQVLGPVCWQQLDLKMAVRVLWGGLSLLRVLWCLLPQTGYVHPD
EFFQSPEVMAEDILGVQAARPWEFYPSSSCRSVLFPLLISGSTFWLLRLWEELGPWPGLV
SGYALLVGPRLLLTALSFALDGAVYHLAPPMGADRWNALALLSGSYVTLVFYTRTFSNTI
EGLLFTWLLVLVSSHVTWGPTRKEPAPGPRWRSWLLGGIVAAGFFNRPTFLAFAVVPLYL
WGTRGATNPGLKSLTREALVLLPGAALTAAVFVATDSWYFSSPATSRNLVLTPVNFLHYN
LNPQNLARHGTHARLTHLAVNGFLLFGVLHAQALQAAWQRLQVGLQASAQMGLLRALGAR
SLLSSPRSYLLLLYFMPLALLSAFSHQEARFLIPLLVPLVLLCSPQTQPVPWKGTVVLFN
ALGALLFGCLHQGGLVPGLEYLEQVVHAPVLPSTPTHYTLLFTHTYMPPRHLLHLPGLGA
PVEVVDMGGTEDWALCQTLKSFTRQPACQVAGGPWLCRLFVVTPGTTRRAVEKCSFPFKN
ETLLFPHLTLEDPPALSSLLSGAWRDHLSLHIVELGEET
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctgtggatccagcgtagcatctgtagcagctgggacatcattccaggttttg
ggcccggtgtgttggcaacaactggatctgaagatggcagtcagggtgctttggggtggt
ctcagcctgctccgagtgctgtggtgtctccttccgcagacgggctatgtgcacccagat
gagttcttccagtcccctgaggtgatggcagaggacatcctgggcgttcaggccgcgcgg
ccctgggagttttaccccagcagctcctgccgctcggtgctcttccccctgctgatctct
ggttccaccttctggctgctcaggctctgggaggagctggggccgtggcctggcctggtg
agcggctatgcgctgctggtggggcctcgactcctcctcactgccctttcctttgctctg
gacggggccgtgtaccacctggccccgccgatgggggcggatcgctggaacgccctggcc
ctgctgtctggttcctacgtcaccctggtcttctacacaaggaccttctccaacaccatt
gagggactcctcttcacgtggctgctggtgctggtatcctcccatgtaacgtggggccct
acacgcaaggagccggcgccgggtccacggtggcgcagctggcttcttggaggcattgtg
gctgctggcttcttcaaccggcccacctttctggcctttgctgtggtccccctctacctc
tggggcactcgtggagccacaaaccctggtttgaagtctctgacccgggaggccctggtg
ctgctccctggggcagccctcacagcagcggtgtttgtggccacggacagctggtatttc
tccagccccgctacatccaggaaccttgtcctgacacctgtcaacttcttgcactacaac
ctgaatccccaaaacctggcgagacatggcacgcacgcgcggctcactcacctggcagtc
aacggcttcctgctcttcggggtgctgcatgcccaggccctgcaggctgcgtggcaacgg
ctgcaagtcggcctccaggcctctgcacaaatgggcctcctgagggcactgggtgcccgg
agcctgctgtccagccccaggtcctatctccttctcctctacttcatgcctctggccctg
ctatctgcctttagccaccaggaggctcggttcctgattcccctcctggtccccctggtc
ctgctttgtagtccacagacgcagcctgtgccttggaagggcactgtggtcctcttcaac
gccctcggtgccctcctcttcggctgcctgcatcaggggggcctggtgcctggcctggag
tacctggagcaggtggtccatgcccctgtgctcccaagcacacccacccactacacactc
ctcttcactcacacctacatgcccccccggcacctcctacacctcccaggcctgggggca
ccagtggaggtggtggacatgggggggactgaggactgggccctgtgccaaaccctgaaa
agcttcaccagacaaccagcctgccaagtggctggtgggccatggctctgccgcctcttt
gtggtaacccctggcaccaccaggcgtgccgtggagaagtgcagcttccccttcaagaat
gaaacacttttatttccccatctgaccctggaggatccaccagccctgtcctccttgctg
agtggggcttggagggaccacctcagtcttcacattgtggagctgggggaagaaacctga

  All links  
No link information was found.   
DBGET integrated database retrieval system