KEGG   Homo sapiens (human): 6482Help
Entry
6482              CDS       T01001                                 

Gene name
ST3GAL1, Gal-NAc6S, SIAT4A, SIATFL, ST3GalA, ST3GalA.1, ST3GalIA, ST3GalIA,1, ST3O
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 1
  KO
K00780  beta-galactoside alpha-2,3-sialyltransferase (sialyltransferase 4A) [EC:2.4.99.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00512  Mucin type O-glycan biosynthesis
hsa00533  Glycosaminoglycan biosynthesis - keratan sulfate
hsa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
hsa00604  Glycosphingolipid biosynthesis - ganglio series
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    6482 (ST3GAL1)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    6482 (ST3GAL1)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    6482 (ST3GAL1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    6482 (ST3GAL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.4  beta-galactoside alpha-2,3-sialyltransferase
     6482 (ST3GAL1)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   6482 (ST3GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29 GAIN
Motif
Other DBs
NCBI-GeneID: 6482
NCBI-ProteinID: NP_003024
OMIM: 607187
HGNC: 10862
Ensembl: ENSG00000008513
Vega: OTTHUMG00000164534
Pharos: Q11201(Tbio)
UniProt: Q11201 A0A024R9L6
Position
8q24.22
AA seq 340 aa AA seqDB search
MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENLKRLIKHRPCT
CTHCIGQRKLSAWFDERFNQTMQPLLTAQNALLEDDTYRWWLRLQREKKPNNLNDTIKEL
FRVVPGNVDPMLEKRSVGCRRCAVVGNSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEAD
VGTKTTHHLVYPESFRELGDNVSMILVPFKTIDLEWVVSAITTGTISHTYIPVPAKIRVK
QDKILIYHPAFIKYVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHY
WENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccctgcggaagaggaccctgaaagtgctcaccttcctcgtgctcttcatcttc
ctcacctccttcttcctgaactactcccacaccatggtggccaccacctggttccccaag
cagatggtcctggagctctccgagaacctgaagagactgatcaagcacaggccttgcacc
tgcacccactgcatcgggcagcgcaagctctcggcctggttcgatgagaggttcaaccag
accatgcagccgctgctgaccgcccagaacgcgctcttggaggacgacacctaccgatgg
tggctgaggctccagcgggagaagaagcccaataacttgaatgacaccatcaaggagctg
ttcagagtggtgcctgggaatgtggaccctatgctggagaagaggtcggtgggctgccgg
cgctgcgccgttgtgggcaactcgggcaacctgagggagtcttcttatgggcctgagata
gacagtcacgactttgtcctcaggatgaacaaggcgcccacggcagggtttgaagctgat
gttgggaccaagaccacccaccatctggtgtaccctgagagcttccgggagctgggagat
aatgtcagcatgatcctggtgcccttcaagaccatcgacttggagtgggtggtgagcgcc
atcaccacgggcaccatttcccacacctacatcccggttcctgcaaagatcagagtgaaa
caggataagatcctgatctaccacccagccttcatcaagtatgtctttgacaactggctg
caagggcacgggcgatacccatctaccggcatcctctcggtcatcttctcaatgcatgtc
tgcgatgaggtggacttgtacggcttcggggcagacagcaaagggaactggcaccactac
tgggagaacaacccatccgcgggggcttttcgcaagacgggggtgcacgatgcagacttt
gagtctaacgtgacggccaccttggcctccatcaataaaatccggatcttcaaggggaga
tga

DBGET integrated database retrieval system