KEGG   Homo sapiens (human): 6482Help
Entry
6482              CDS       T01001                                 

Gene name
ST3GAL1, Gal-NAc6S, SIAT4A, SIATFL, ST3GalA, ST3GalA.1, ST3GalIA, ST3GalIA,1, ST3O
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (EC:2.4.99.4)
Orthology
K00780  
beta-galactoside alpha-2,3-sialyltransferase (sialyltransferase 4A) [EC:2.4.99.4]
Organism
hsa  Homo sapiens (human)
Pathway
Mucin type O-Glycan biosynthesis
Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    6482 (ST3GAL1)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    6482 (ST3GAL1)
   00603 Glycosphingolipid biosynthesis - globo series
    6482 (ST3GAL1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    6482 (ST3GAL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.4  beta-galactoside alpha-2,3-sialyltransferase
     6482 (ST3GAL1)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   6482 (ST3GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24.22
AA seq 340 aa AA seqDB search
MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENLKRLIKHRPCT
CTHCIGQRKLSAWFDERFNQTMQPLLTAQNALLEDDTYRWWLRLQREKKPNNLNDTIKEL
FRVVPGNVDPMLEKRSVGCRRCAVVGNSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEAD
VGTKTTHHLVYPESFRELGDNVSMILVPFKTIDLEWVVSAITTGTISHTYIPVPAKIRVK
QDKILIYHPAFIKYVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHY
WENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccctgcggaagaggaccctgaaagtgctcaccttcctcgtgctcttcatcttc
ctcacctccttcttcctgaactactcccacaccatggtggccaccacctggttccccaag
cagatggtcctggagctctccgagaacctgaagagactgatcaagcacaggccttgcacc
tgcacccactgcatcgggcagcgcaagctctcggcctggttcgatgagaggttcaaccag
accatgcagccgctgctgaccgcccagaacgcgctcttggaggacgacacctaccgatgg
tggctgaggctccagcgggagaagaagcccaataacttgaatgacaccatcaaggagctg
ttcagagtggtgcctgggaatgtggaccctatgctggagaagaggtcggtgggctgccgg
cgctgcgccgttgtgggcaactcgggcaacctgagggagtcttcttatgggcctgagata
gacagtcacgactttgtcctcaggatgaacaaggcgcccacggcagggtttgaagctgat
gttgggaccaagaccacccaccatctggtgtaccctgagagcttccgggagctgggagat
aatgtcagcatgatcctggtgcccttcaagaccatcgacttggagtgggtggtgagcgcc
atcaccacgggcaccatttcccacacctacatcccggttcctgcaaagatcagagtgaaa
caggataagatcctgatctaccacccagccttcatcaagtatgtctttgacaactggctg
caagggcacgggcgatacccatctaccggcatcctctcggtcatcttctcaatgcatgtc
tgcgatgaggtggacttgtacggcttcggggcagacagcaaagggaactggcaccactac
tgggagaacaacccatccgcgggggcttttcgcaagacgggggtgcacgatgcagacttt
gagtctaacgtgacggccaccttggcctccatcaataaaatccggatcttcaaggggaga
tga

DBGET integrated database retrieval system