KEGG   Homo sapiens (human): 6483Help
Entry
6483              CDS       T01001                                 

Gene name
ST3GAL2, Gal-NAc6S, SIAT4B, ST3GALII, ST3GalA.2
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 2 (EC:2.4.99.4)
Orthology
K03368  
beta-galactoside alpha-2,3-sialyltransferase (sialyltransferase 4B) [EC:2.4.99.4]
Organism
hsa  Homo sapiens (human)
Pathway
Mucin type O-Glycan biosynthesis
Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    6483 (ST3GAL2)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    6483 (ST3GAL2)
   00603 Glycosphingolipid biosynthesis - globo series
    6483 (ST3GAL2)
   00604 Glycosphingolipid biosynthesis - ganglio series
    6483 (ST3GAL2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.4  beta-galactoside alpha-2,3-sialyltransferase
     6483 (ST3GAL2)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   6483 (ST3GAL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
16q22.1
AA seq 350 aa AA seqDB search
MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRL
SKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFK
SHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMN
QAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTY
APVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFG
ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgctccctgcgggtgtggttcctctccgtggccttcctgctggtgttcatcatg
tccctgctcttcacctactcgcaccacagcatggccacgctcccctacctggactcaggg
gccctggatgggacgcaccgggtgaagctggtgcccggctatgccggcctgcagcgcctc
agcaaggagaggctctcgggcaagagctgtgcctgtcgccgctgcatgggcgatgccggt
gcctccgactggtttgacagccactttgacggtaacatttcccccgtctggacccgagag
aacatggatcttccaccggacgtccagaggtggtggatgatgctgcagccccagttcaag
tcacacaacaccaatgaggtgctggagaagctgttccagatagtgcctggcgagaacccc
taccgcttccgggacccccaccagtgccggcgctgtgccgtggtggggaactcgggcaac
ctgcggggctctggctatgggcaggacgtggacgggcacaacttcatcatgaggatgaat
caggcgccaaccgtgggctttgagcaggatgttggcagccgaaccacccaccatttcatg
taccctgagagtgccaagaacctgcccgccaacgtcagcttcgtgctggtgcccttcaag
gtcctggaccttctgtggatcgccagcgccttgtccacggggcagatccgattcacctac
gccccagtgaagtccttccttcgagtggataaagaaaaggtccagatctacaacccagcc
ttcttcaagtatatccacgacaggtggacagagcatcacgggcggtacccttccacgggg
atgctggtgcttttctttgccctgcatgtgtgtgatgaggtgaacgtgtacgggttcggg
gccgacagccggggcaactggcaccactactgggagaacaaccggtacgcgggcgagttc
cggaagactggcgtgcacgacgcggacttcgaggcccacatcatcgacatgctggccaag
gccagcaagatcgaagtctaccggggcaactga

DBGET integrated database retrieval system