KEGG   Homo sapiens (human): 6487Help
Entry
6487              CDS       T01001                                 

Gene name
ST3GAL3, EIEE15, MRT12, SIAT6, ST3GALII, ST3Gal_III, ST3GalIII, ST3N
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 3
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00514  Other types of O-glycan biosynthesis
hsa00515  Mannose type O-glycan biosynthesis
hsa00533  Glycosaminoglycan biosynthesis - keratan sulfate
hsa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
hsa01100  Metabolic pathways
Disease
H00606  Early infantile epileptic encephalopathy
H00768  Nonsyndromic autosomal recessive mental retardation (NS-ARMR)
H01460  West syndrome
H01813  Lennox-Gastaut syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    6487 (ST3GAL3)
   00514 Other types of O-glycan biosynthesis
    6487 (ST3GAL3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    6487 (ST3GAL3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    6487 (ST3GAL3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     6487 (ST3GAL3)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   6487 (ST3GAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 6487
NCBI-ProteinID: NP_006270
OMIM: 606494
HGNC: 10866
Ensembl: ENSG00000126091
Vega: OTTHUMG00000007561
Pharos: Q11203(Tbio)
UniProt: Q11203
Position
1p34.1
AA seq 375 aa AA seqDB search
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRL
GFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARI
REFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDD
YDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLK
YIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIP
TLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLR
KLVKARVITDLSSGI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgggactcttggtatttgtgcgcaatctgctgctagccctctgcctctttctggtactg
ggatttttgtattattctgcgtggaagctacacttactccagtgggaggaggactccaat
tcagtggttctttcctttgactccgctggacaaacactaggctcagagtatgatcggttg
ggcttcctcctgaatctggactctaaactgcctgctgaattagccaccaagtacgcaaac
ttttcagagggagcttgcaagcctggctatgcttcagccttgatgacggccatcttcccc
cggttctccaagccagcacccatgttcctggatgactcctttcgcaagtgggctagaatc
cgggagttcgtgccgccttttgggatcaaaggtcaagacaatctgatcaaagccatcttg
tcagtcaccaaagagtaccgcctgacccctgccttggacagcctccgctgccgccgctgc
atcatcgtgggcaatggaggcgttcttgccaacaagtctctggggtcacgaattgacgac
tatgacattgtggtgagactgaattcagcaccagtgaaaggctttgagaaggacgtgggc
agcaaaacgacactgcgcatcacctaccccgagggcgccatgcagcggcctgagcagtac
gagcgcgattctctctttgtcctcgccggcttcaagtggcaggactttaagtggttgaaa
tacatcgtctacaaggagagagtgagtgcatcggatggcttctggaaatctgtggccact
cgagtgcccaaggagccccctgagattcgaatcctcaacccatatttcatccaggaggcc
gccttcaccctcattggcctgcccttcaacaatggcctcatgggccgggggaacatccct
acccttggcagtgtggcagtgaccatggcactacacggctgtgacgaggtggcagtcgca
ggatttggctatgacatgagcacacccaacgcacccctgcactactatgagaccgttcgc
atggcagccatcaaagagtcctggacgcacaatatccagcgagagaaagagtttctgcgg
aagctggtgaaagctcgcgtcatcactgatctaagcagtggcatctga

DBGET integrated database retrieval system