KEGG   Homo sapiens (human): 6487Help
Entry
6487              CDS       T01001                                 

Gene name
ST3GAL3, EIEE15, MRT12, SIAT6, ST3GALII, ST3GalIII, ST3N
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 3 (EC:2.4.99.6)
Orthology
K00781  
N-acetyllactosaminide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
hsa  Homo sapiens (human)
Pathway
Other types of O-glycan biosynthesis
Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Disease
H00768  
Nonsyndromic autosomal recessive mental retardation (NS-ARMR)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    6487 (ST3GAL3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    6487 (ST3GAL3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    6487 (ST3GAL3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     6487 (ST3GAL3)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   6487 (ST3GAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p34.1
AA seq 345 aa AA seqDB search
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRL
GFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARI
REFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDD
YDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLK
YIVYKERVEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPN
APLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgggactcttggtatttgtgcgcaatctgctgctagccctctgcctctttctggtactg
ggatttttgtattattctgcgtggaagctacacttactccagtgggaggaggactccaat
tcagtggttctttcctttgactccgctggacaaacactaggctcagagtatgatcggttg
ggcttcctcctgaatctggactctaaactgcctgctgaattagccaccaagtacgcaaac
ttttcagagggagcttgcaagcctggctatgcttcagccttgatgacggccatcttcccc
cggttctccaagccagcacccatgttcctggatgactcctttcgcaagtgggctagaatc
cgggagttcgtgccgccttttgggatcaaaggtcaagacaatctgatcaaagccatcttg
tcagtcaccaaagagtaccgcctgacccctgccttggacagcctccgctgccgccgctgc
atcatcgtgggcaatggaggcgttcttgccaacaagtctctggggtcacgaattgacgac
tatgacattgtggtgagactgaattcagcaccagtgaaaggctttgagaaggacgtgggc
agcaaaacgacactgcgcatcacctaccccgagggcgccatgcagcggcctgagcagtac
gagcgcgattctctctttgtcctcgccggcttcaagtggcaggactttaagtggttgaaa
tacatcgtctacaaggagagagtggaggccgccttcaccctcattggcctgcccttcaac
aatggcctcatgggccgggggaacatccctacccttggcagtgtggcagtgaccatggca
ctacacggctgtgacgaggtggcagtcgcaggatttggctatgacatgagcacacccaac
gcacccctgcactactatgagaccgttcgcatggcagccatcaaagagtcctggacgcac
aatatccagcgagagaaagagtttctgcggaagctggtgaaagctcgcgtcatcactgat
ctaagcagtggcatctga

DBGET integrated database retrieval system