KEGG   Homo sapiens (human): 6484Help
Entry
6484              CDS       T01001                                 

Gene name
ST3GAL4, CGS23, NANTA3, SAT3, SIAT4, SIAT4C, ST3GalIV, STZ
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 4 (EC:2.4.99.4)
Orthology
K03494  
beta-galactoside alpha-2,3-sialyltransferase (sialyltransferase 4C) [EC:2.4.99.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    6484 (ST3GAL4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.4  beta-galactoside alpha-2,3-sialyltransferase
     6484 (ST3GAL4)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   6484 (ST3GAL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q24.2
AA seq 333 aa AA seqDB search
MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFG
NYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRC
VVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVE
NNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIA
ADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQIT
LKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcaagtcccgctggaagctcctggccatgttggctctggtcctggtcgtcatg
gtgtggtattccatctcccgggaagacaggtacatcgagcttttttattttcccatccca
gagaagaaggagccgtgcctccagggtgaggcagagagcaaggcctctaagctctttggc
aactactcccgggatcagcccatcttcctgcggcttgaggattatttctgggtcaagacg
ccatctgcttacgagctgccctatgggaccaaggggagtgaggatctgctcctccgggtg
ctagccatcaccagctcctccatccccaagaacatccagagcctcaggtgccgccgctgt
gtggtcgtggggaacgggcaccggctgcggaacagctcactgggagatgccatcaacaag
tacgatgtggtcatcagattgaacaatgccccagtggctggctatgagggtgacgtgggc
tccaagaccaccatgcgtctcttctaccctgaatctgcccacttcgaccccaaagtagaa
aacaacccagacacactcctcgtcctggtagctttcaaggcaatggacttccactggatt
gagaccatcctgagtgataagaagcgggtgcgaaagggtttctggaaacagcctcccctc
atctgggatgtcaatcctaaacagattcggattctcaaccccttcttcatggagattgca
gctgacaaactgctgagcctgccaatgcaacagccacggaagattaagcagaagcccacc
acgggcctgttggccatcacgctggccctccacctctgtgacttggtgcacattgccggc
tttggctacccagacgcctacaacaagaagcagaccattcactactatgagcagatcacg
ctcaagtccatggcggggtcaggccataatgtctcccaagaggccctggccattaagcgg
atgctggagatgggagctatcaagaacctcacgtccttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system