KEGG   Homo sapiens (human): 8869Help
Entry
8869              CDS       T01001                                 

Gene name
ST3GAL5, SATI, SIAT9, SIATGM3S, ST3GalV
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 5 (EC:2.4.99.9)
  KO
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Disease
H00996  
Amish infantile epilepsy syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    8869 (ST3GAL5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.9  lactosylceramide alpha-2,3-sialyltransferase
     8869 (ST3GAL5)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   8869 (ST3GAL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p11.2
AA seq 418 aa AA seqDB search
MRTKAAGCAERRPLQPRTEAAAAPAGRAMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRP
SLLLKDILKCTLLVFGVWILYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKEC
RPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPE
HDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTI
RMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIP
LQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAG
FGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgaaggcggcgggctgcgcggagcggcgtcccctgcagccgcggaccgaggca
gcggcggcacctgccggccgagcaatgccaagtgagtacacctatgtgaaactgagaagt
gattgctcgaggccttccctgcaatggtacacccgagctcaaagcaagatgagaaggccc
agcttgttattaaaagacatcctcaaatgtacattgcttgtgtttggagtgtggatcctt
tatatcctcaagttaaattatactactgaagaatgtgacatgaaaaaaatgcattatgtg
gaccctgaccatgtaaagagagctcagaaatatgctcagcaagtcttgcagaaggaatgt
cgtcccaagtttgccaagacatcaatggcgctgttatttgagcacaggtatagcgtggac
ttactcccttttgtgcagaaggcccccaaagacagtgaagctgagtccaagtacgatcct
ccttttgggttccggaagttctccagtaaagtccagaccctcttggaactcttgccagag
cacgacctccctgaacacttgaaagccaagacctgtcggcgctgtgtggttattggaagc
ggaggaatactgcacggattagaactgggccacaccctgaaccagttcgatgttgtgata
aggttaaacagtgcaccagttgagggatattcagaacatgttggaaataaaactactata
aggatgacttatccagagggcgcaccactgtctgaccttgaatattattccaatgactta
tttgttgctgttttatttaagagtgttgatttcaactggcttcaagcaatggtaaaaaag
gaaaccctgccattctgggtacgactcttcttttggaagcaggtggcagaaaaaatccca
ctgcagccaaaacatttcaggattttgaatccagttatcatcaaagagactgcctttgac
atccttcagtactcagagcctcagtcaaggttctggggccgagataagaacgtccccaca
atcggtgtcattgccgttgtcttagccacacatctgtgcgatgaagtcagtttggcgggt
tttggatatgacctcaatcaacccagaacacctttgcactacttcgacagtcaatgcatg
gctgctatgaactttcagaccatgcataatgtgacaacggaaaccaagttcctcttaaag
ctggtcaaagagggagtggtgaaagatctcagtggaggcattgatcgtgaattttga

DBGET integrated database retrieval system