KEGG   Homo sapiens (human): 8869Help
Entry
8869              CDS       T01001                                 

Gene name
ST3GAL5, SATI, SIAT9, SIATGM3S, ST3GalV
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 5 (EC:2.4.99.9)
Orthology
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Disease
H00996  
Amish infantile epilepsy syndrome
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:hsa00604]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p11.2
AA seq 395 aa AA seqDB search
MASVPMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRPSLLLKDILKCTLLVFGVWILYIL
KLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLP
FVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGSGGI
LHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVA
VLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQ
YSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAM
NFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgttccaatgccaagtgagtacacctatgtgaaactgagaagtgattgctcg
aggccttccctgcaatggtacacccgagctcaaagcaagatgagaaggcccagcttgtta
ttaaaagacatcctcaaatgtacattgcttgtgtttggagtgtggatcctttatatcctc
aagttaaattatactactgaagaatgtgacatgaaaaaaatgcattatgtggaccctgac
catgtaaagagagctcagaaatatgctcagcaagtcttgcagaaggaatgtcgtcccaag
tttgccaagacatcaatggcgctgttatttgagcacaggtatagcgtggacttactccct
tttgtgcagaaggcccccaaagacagtgaagctgagtccaagtacgatcctccttttggg
ttccggaagttctccagtaaagtccagaccctcttggaactcttgccagagcacgacctc
cctgaacacttgaaagccaagacctgtcggcgctgtgtggttattggaagcggaggaata
ctgcacggattagaactgggccacaccctgaaccagttcgatgttgtgataaggttaaac
agtgcaccagttgagggatattcagaacatgttggaaataaaactactataaggatgact
tatccagagggcgcaccactgtctgaccttgaatattattccaatgacttatttgttgct
gttttatttaagagtgttgatttcaactggcttcaagcaatggtaaaaaaggaaaccctg
ccattctgggtacgactcttcttttggaagcaggtggcagaaaaaatcccactgcagcca
aaacatttcaggattttgaatccagttatcatcaaagagactgcctttgacatccttcag
tactcagagcctcagtcaaggttctggggccgagataagaacgtccccacaatcggtgtc
attgccgttgtcttagccacacatctgtgcgatgaagtcagtttggcgggttttggatat
gacctcaatcaacccagaacacctttgcactacttcgacagtcaatgcatggctgctatg
aactttcagaccatgcataatgtgacaacggaaaccaagttcctcttaaagctggtcaaa
gagggagtggtgaaagatctcagtggaggcattgatcgtgaattttga

DBGET integrated database retrieval system