KEGG   Homo sapiens (human): 10402Help
Entry
10402             CDS       T01001                                 

Gene name
ST3GAL6, SIAT10, ST3GALVI
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 6 (EC:2.4.99.-)
Orthology
K03792  
beta-galactoside alpha-2,3-sialyltransferase (sialyltransferase 10) [EC:2.4.99.10]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    10402 (ST3GAL6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.10  neolactotetraosylceramide alpha-2,3-sialyltransferase
     10402 (ST3GAL6)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   10402 (ST3GAL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
3q12.1
AA seq 245 aa AA seqDB search
MRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMN
NGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKI
NTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITL
AFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVI
NLTQD
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagaacatcagcggaatattttcgacttgctctttcaaaactgcagagttgtgatctc
tttgatgagtttgacaacataccctgtaaaaagtgtgtggtggttggtaatggaggagtt
ttgaagaataagacattaggagaaaaaatcgactcctatgatgtaataataagaatgaat
aatggtcctgttttaggacatgaagaagaagttgggagaaggacaaccttccgacttttt
tatccagaatctgttttttcagatcctattcacaatgaccctaatacgacagtgattctc
actgcttttaagccacatgatttaaggtggctgttggaattgttgatgggtgacaaaata
aacactaatggtttttggaagaaaccagccttaaacctgatttataaaccttatcaaatc
cgaatattagatcctttcattatcagaacagcagcttatgaactgcttcattttccaaaa
gtgtttcccaaaaatcagaaacctaaacacccaacaacaggaattattgccatcacattg
gcgttttacatatgtcacgaagttcacctagctggttttaaatacaacttttctgacctc
aagagtcctttgcactactatgggaatgccaccatgtctttgatgaataagaacgcgtat
cacaatgtgactgcagagcagctctttttgaaggacattatagaaaaaaacctcgtaatc
aacttgactcaagattga

DBGET integrated database retrieval system