KEGG   Homo sapiens (human): 6480Help
Entry
6480              CDS       T01001                                 

Gene name
ST6GAL1, SIAT1, ST6GalI, ST6N
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 1
  KO
K00778  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00514  Other types of O-glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    6480 (ST6GAL1)
   00514 Other types of O-glycan biosynthesis
    6480 (ST6GAL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     6480 (ST6GAL1)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   6480 (ST6GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 6480
NCBI-ProteinID: NP_003023
OMIM: 109675
HGNC: 10860
Ensembl: ENSG00000073849
Vega: OTTHUMG00000156500
Pharos: P15907(Tbio)
UniProt: P15907
Structure
PDB: 

Jmol
Position
3q27.3
AA seq 406 aa AA seqDB search
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDS
QSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMN
KYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGP
WGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTE
KRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQM
PWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFF
DSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattcacaccaacctgaagaaaaagttcagctgctgcgtcctggtctttcttctgttt
gcagtcatctgtgtgtggaaggaaaagaagaaagggagttactatgattcctttaaattg
caaaccaaggaattccaggtgttaaagagtctggggaaattggccatggggtctgattcc
cagtctgtatcctcaagcagcacccaggacccccacaggggccgccagaccctcggcagt
ctcagaggcctagccaaggccaaaccagaggcctccttccaggtgtggaacaaggacagc
tcttccaaaaaccttatccctaggctgcaaaagatctggaagaattacctaagcatgaac
aagtacaaagtgtcctacaaggggccaggaccaggcatcaagttcagtgcagaggccctg
cgctgccacctccgggaccatgtgaatgtatccatggtagaggtcacagattttcccttc
aatacctctgaatgggagggttatctgcccaaggagagcattaggaccaaggctgggcct
tggggcaggtgtgctgttgtgtcgtcagcgggatctctgaagtcctcccaactaggcaga
gaaatcgatgatcatgacgcagtcctgaggtttaatggggcacccacagccaacttccaa
caagatgtgggcacaaaaactaccattcgcctgatgaactctcagttggttaccacagag
aagcgcttcctcaaagacagtttgtacaatgaaggaatcctaattgtatgggacccatct
gtataccactcagatatcccaaagtggtaccagaatccggattataatttctttaacaac
tacaagacttatcgtaagctgcaccccaatcagcccttttacatcctcaagccccagatg
ccttgggagctatgggacattcttcaagaaatctccccagaagagattcagccaaacccc
ccatcctctgggatgcttggtatcatcatcatgatgacgctgtgtgaccaggtggatatt
tatgagttcctcccatccaagcgcaagactgacgtgtgctactactaccagaagttcttc
gatagtgcctgcacgatgggtgcctaccacccgctgctctatgagaagaatttggtgaag
catctcaaccagggcacagatgaggacatctacctgcttggaaaagccacactgcctggc
ttccggaccattcactgctaa

DBGET integrated database retrieval system