KEGG   Homo sapiens (human): 55808Help
Entry
55808             CDS       T01001                                 

Gene name
ST6GALNAC1, HSY11339, SIAT7A, ST6GalNAcI, STYI
Definition
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 (EC:2.4.99.3)
Orthology
K03479  
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7A) [EC:2.4.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    55808 (ST6GALNAC1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.3  alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase
     55808 (ST6GALNAC1)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   55808 (ST6GALNAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.1
AA seq 468 aa AA seqDB search
MVNTLSPRGQDAGMASGRTEAQSWKSQDTKTTQGNGGQTRKLTASRTVSEKHQGKAATTA
KTLIPKSQHRMLAPTGAVSTRTRQKGVTTAVIPPKEKKPQATPPPAPFQSPTTQRNQRLK
AANFKSEPRWDFEEKYSFEIGGLQTTCPDSVKIKASKSLWLQKLFLPNLTLFLDSRHFNQ
SEWDRLEHFAPPFGFMELNYSLVQKVVTRFPPVPQQQLLLASLPAGSLRCITCAVVGNGG
ILNNSHMGQEIDSHDYVFRLSGALIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKN
VPLGKDVRYLHFLEGTRDYEWLEALLMNQTVMSKNLFWFRHRPQEAFREALHMDRYLLLH
PDFLRYMKNRFLRSKTLDGAHWRIYRPTTGALLLLTALQLCDQVSAYGFITEGHERFSDH
YYDTSWKRLIFYINHDFKLEREVWKRLHDEGIIRLYQRPGPGTAKAKN
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacacactgtcacccagagggcaagatgcagggatggcctctggcaggacagag
gcacaatcatggaagagccaggacacaaagacgacccaaggaaatgggggccagaccagg
aagctgacggcctccaggacggtgtcagagaagcaccagggcaaagcggcaaccacagcc
aagacgctcattcccaaaagtcagcacagaatgctggctcccacaggagcagtgtcaaca
aggacgagacagaaaggagtgaccacagcagtcatcccacctaaggagaagaaacctcag
gccaccccaccccctgcccctttccagagccccacgacgcagagaaaccaaagactgaag
gccgccaacttcaaatctgagcctcggtgggattttgaggaaaaatacagcttcgaaata
ggaggccttcagacgacttgccctgactctgtgaagatcaaagcctccaagtcgctgtgg
ctccagaaactctttctgcccaacctcactctcttcctggactccagacacttcaaccag
agtgagtgggaccgcctggaacactttgcaccaccctttggcttcatggagctcaactac
tccttggtgcagaaggtcgtgacacgcttccctccagtgccccagcagcagctgctcctg
gccagcctccccgctgggagcctccggtgcatcacctgtgccgtggtgggcaacgggggc
atcctgaacaactcccacatgggccaggagatagacagtcacgactacgtgttccgattg
agcggagctctcattaaaggctacgaacaggatgtggggactcggacatccttctacggc
tttaccgccttctccctgacccagtcactccttatattgggcaatcggggtttcaagaac
gtgcctcttgggaaggacgtccgctacttgcacttcctggaaggcacccgggactatgag
tggctggaagcactgcttatgaatcagacggtgatgtcaaaaaaccttttctggttcagg
cacagaccccaggaagcttttcgggaagccctgcacatggacaggtacctgttgctgcac
ccagactttctccgatacatgaagaacaggtttctgaggtctaagaccctggatggtgcc
cactggaggatataccgccccaccactggggccctcctgctgctcactgcccttcagctc
tgtgaccaggtgagtgcttatggcttcatcactgagggccatgagcgcttttctgatcac
tactatgatacatcatggaagcggctgatcttttacataaaccatgacttcaagctggag
agagaagtctggaagcggctacacgatgaagggataatccggctgtaccagcgtcctggt
cccggaactgccaaagccaagaactga

DBGET integrated database retrieval system