KEGG   Homo sapiens (human): 55808Help
Entry
55808             CDS       T01001                                 

Gene name
ST6GALNAC1, HSY11339, SIAT7A, ST6GalNAcI, STYI
Definition
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 (EC:2.4.99.3)
Orthology
K03479  
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7A) [EC:2.4.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:hsa00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.1
AA seq 600 aa AA seqDB search
MRSCLWRCRHLSQGVQWSLLLAVLVFFLFALPSFIKEPQTKPSRHQRTENIKERSLQSLA
KPKSQAPTRARRTTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQ
RAAWKSPEKEKTMVNTLSPRGQDAGMASGRTEAQSWKSQDTKTTQGNGGQTRKLTASRTV
SEKHQGKAATTAKTLIPKSQHRMLAPTGAVSTRTRQKGVTTAVIPPKEKKPQATPPPAPF
QSPTTQRNQRLKAANFKSEPRWDFEEKYSFEIGGLQTTCPDSVKIKASKSLWLQKLFLPN
LTLFLDSRHFNQSEWDRLEHFAPPFGFMELNYSLVQKVVTRFPPVPQQQLLLASLPAGSL
RCITCAVVGNGGILNNSHMGQEIDSHDYVFRLSGALIKGYEQDVGTRTSFYGFTAFSLTQ
SLLILGNRGFKNVPLGKDVRYLHFLEGTRDYEWLEALLMNQTVMSKNLFWFRHRPQEAFR
EALHMDRYLLLHPDFLRYMKNRFLRSKTLDGAHWRIYRPTTGALLLLTALQLCDQVSAYG
FITEGHERFSDHYYDTSWKRLIFYINHDFKLEREVWKRLHDEGIIRLYQRPGPGTAKAKN
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcctgcctgtggagatgcaggcacctgagccaaggcgtccagtggtccttgctt
ctggctgtcctggtcttctttctcttcgccttgccctcttttattaaggagcctcaaaca
aagccttccaggcatcaacgcacagagaacattaaagaaaggtctctacagtccctggca
aagcctaagtcccaggcacccacaagggcaaggaggacaaccatctatgcagagccagtg
ccagagaacaatgccctcaacacacaaacccagcccaaggcccacaccaccggagacaga
ggaaaggaggccaaccaggcaccgccggaggagcaggacaaggtgccccacacagcacag
agggcagcatggaagagcccagaaaaagagaaaaccatggtgaacacactgtcacccaga
gggcaagatgcagggatggcctctggcaggacagaggcacaatcatggaagagccaggac
acaaagacgacccaaggaaatgggggccagaccaggaagctgacggcctccaggacggtg
tcagagaagcaccagggcaaagcggcaaccacagccaagacgctcattcccaaaagtcag
cacagaatgctggctcccacaggagcagtgtcaacaaggacgagacagaaaggagtgacc
acagcagtcatcccacctaaggagaagaaacctcaggccaccccaccccctgcccctttc
cagagccccacgacgcagagaaaccaaagactgaaggccgccaacttcaaatctgagcct
cggtgggattttgaggaaaaatacagcttcgaaataggaggccttcagacgacttgccct
gactctgtgaagatcaaagcctccaagtcgctgtggctccagaaactctttctgcccaac
ctcactctcttcctggactccagacacttcaaccagagtgagtgggaccgcctggaacac
tttgcaccaccctttggcttcatggagctcaactactccttggtgcagaaggtcgtgaca
cgcttccctccagtgccccagcagcagctgctcctggccagcctccccgctgggagcctc
cggtgcatcacctgtgccgtggtgggcaacgggggcatcctgaacaactcccacatgggc
caggagatagacagtcacgactacgtgttccgattgagcggagctctcattaaaggctac
gaacaggatgtggggactcggacatccttctacggctttaccgccttctccctgacccag
tcactccttatattgggcaatcggggtttcaagaacgtgcctcttgggaaggacgtccgc
tacttgcacttcctggaaggcacccgggactatgagtggctggaagcactgcttatgaat
cagacggtgatgtcaaaaaaccttttctggttcaggcacagaccccaggaagcttttcgg
gaagccctgcacatggacaggtacctgttgctgcacccagactttctccgatacatgaag
aacaggtttctgaggtctaagaccctggatggtgcccactggaggatataccgccccacc
actggggccctcctgctgctcactgcccttcagctctgtgaccaggtgagtgcttatggc
ttcatcactgagggccatgagcgcttttctgatcactactatgatacatcatggaagcgg
ctgatcttttacataaaccatgacttcaagctggagagagaagtctggaagcggctacac
gatgaagggataatccggctgtaccagcgtcctggtcccggaactgccaaagccaagaac
tga

DBGET integrated database retrieval system