KEGG   Homo sapiens (human): 256435Help
Entry
256435            CDS       T01001                                 

Gene name
ST6GALNAC3, PRO7177, SIAT7C, ST6GALNACIII, STY
Definition
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
Orthology
K03373  
N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7C) [EC:2.4.99.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    256435 (ST6GALNAC3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     256435 (ST6GALNAC3)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   256435 (ST6GALNAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1p31.1
AA seq 210 aa AA seqDB search
MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRT
HYGYINVKTQEPLQLDCDLCAIVSNSGQMVGQKVGNEIDRSSCIWRMNNAPTKGYEEDVG
RMTMIRVVSHTSVPLLLKNPDYFFKEANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIY
PNAQIYVTTEKRMSYCDGVFKKETGKDSTE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcatcctgaagagaaagtctgtgattgctgtgagcttcatagcagcgttcctt
ttcctgctggttgtgcgtcttgtaaatgaagtgaatttcccattgctactaaactgcttt
ggacaacctggtacaaagtggataccattctcctacacatacaggcggccccttcgaact
cactatggatacataaatgtgaagacacaagagcctttgcaactggactgtgacctttgt
gccatagtgtcaaactcaggtcagatggttggccagaaggtgggaaatgagatagatcga
tcctcctgcatttggagaatgaacaatgcccccaccaaaggttatgaagaagatgtcggc
cgcatgaccatgattcgagttgtgtcccataccagcgttcctcttttgctaaaaaaccct
gattattttttcaaggaagcgaatactactatttatgttatttggggacctttccgcaat
atgaggaaagatggcaatggcatcgtttacaacatgttgaaaaagacagttggtatctat
ccgaatgcccaaatatacgtgaccacagagaagcgcatgagttactgtgatggagttttt
aagaaggaaactgggaaggacagtacagagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system