KEGG   Homo sapiens (human): 27090Help
Entry
27090             CDS       T01001                                 

Gene name
ST6GALNAC4, IV, SIAT3-C, SIAT3C, SIAT7-D, SIAT7D, ST6GALNACIV, ST6GalNAc
Definition
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4 (EC:2.4.99.7)
Orthology
K03374  
N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7D) [EC:2.4.99.7]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    27090 (ST6GALNAC4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.7  alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3-N-acetylgalactosaminide 6-alpha-sialyltransferase
     27090 (ST6GALNAC4)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   27090 (ST6GALNAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34
AA seq 302 aa AA seqDB search
MKAPGRLVLIILCSVVFSAVYILLCCWAGLPLCLATCLDHHFPTGSRPTVPGPLHFSGYS
SVPDGKPLVREPCRSCAVVSSSGQMLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRST
LRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQ
VYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCR
EKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWR
TE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctccgggtcggctcgtgctcatcatcctgtgctccgtggtcttctctgccgtc
tacatcctcctgtgctgctgggccggcctgcccctctgcctggccacctgcctggaccac
cacttccccacaggctccaggcccactgtgccgggacccctgcacttcagtggatatagc
agtgtgccagatgggaagccgctggtccgcgagccctgccgcagctgtgccgtggtgtcc
agctccggccaaatgctgggctcaggcctgggtgctgagatcgacagtgccgagtgcgtg
ttccgcatgaaccaggcgcccaccgtgggctttgaggcggatgtgggccagcgcagcacc
ctgcgtgtcgtctcacacacaagcgtgccgctgctgctgcgcaactattcacactacttc
cagaaggcccgagacacgctctacatggtgtggggccagggcaggcacatggaccgggtg
ctcggcggccgcacctaccgcacgctgctgcagctcaccaggatgtaccccggcctgcag
gtgtacaccttcacggagcgcatgatggcctactgcgaccagatcttccaggacgagacg
ggcaagaaccggaggcagtcgggctccttcctcagcaccggctggttcaccatgatcctc
gcgctggagctgtgtgaggagatcgtggtctatgggatggtcagcgacagctactgcagg
gagaagagccacccctcagtgccttaccactactttgagaagggccggctagatgagtgt
cagatgtacctggcacacgagcaggcgccccgaagcgcccaccgcttcatcactgagaag
gcggtcttctcccgctgggccaagaagaggcccatcgtgttcgcccatccgtcctggagg
actgagtag

DBGET integrated database retrieval system