KEGG   Homo sapiens (human): 30815Help
Entry
30815             CDS       T01001                                 

Gene name
ST6GALNAC6, SIAT7-F, SIAT7F, ST6GALNACVI
Definition
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
Orthology
K03376  
N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7F) [EC:2.4.99.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    30815 (ST6GALNAC6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     30815 (ST6GALNAC6)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   30815 (ST6GALNAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.11
AA seq 374 aa AA seqDB search
MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYS
SNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGT
KLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVF
IFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHS
WLSTGWFTMVIAVELCDHVHVYGMVPPNYCSGPASSACPTTTTSPRGRTNVSPTSRMSTV
ARATTTASSPRKGSSHRGPSCMASPSPTPPGPRPPSLWDLRRVRGEAASAQPLGQGPSSG
QSRLAGVSPSQSGP
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcttgctcgaggccccccagccagtgtgaacccacatccctgcccccagggccacct
gcaggacgccgacacctacccctcagcagacgccggagagaaatgagtagcaacaaagag
cagcggtcagcagtgttcgtgatcctctttgccctcatcaccatcctcatcctctacagc
tccaacagtgccaatgaggtcttccattacggctccctgcggggccgtagccgccgacct
gtcaacctcaagaagtggagcatcactgacggctatgtccccattctcggcaacaagaca
ctgccctctcggtgccaccagtgtgtgattgtcagcagctccagccacctgctgggcacc
aagctgggccctgagatcgagcgggctgagtgtacaatccgcatgaatgatgcacccacc
actggctactcagctgatgtgggcaacaagaccacctaccgcgtcgtggcccattccagt
gtgttccgcgtgctgaggaggccccaggagtttgtcaaccggacccctgaaaccgtgttc
atcttctgggggcccccgagcaagatgcagaagccccagggcagcctcgtgcgtgtgatc
cagcgagcgggcctggtgttccccaacatggaagcatatgccgtctctcccggccgcatg
cggcaatttgacgacctcttccggggtgagacgggcaaggacagggagaagtctcattcg
tggttgagcacaggctggtttaccatggtgatcgcggtggagttgtgtgaccacgtgcat
gtctatggcatggtcccccccaactactgcagcggccccgcctccagcgcatgccctacc
actactacgagcccaaggggccggacgaatgtgtcacctacatccagaatgagcacagtc
gcaagggcaaccaccaccgcttcatcaccgagaaaagggtcttctcatcgtgggcccagc
tgtatggcatcaccttctcccacccctcctggacctaggccacccagcctgtgggacctc
aggagggtcagaggagaagcagcctccgcccagccgctaggccagggaccatcttctggc
caatcaaggcttgctggagtgtctcccagccaatcagggccttga

DBGET integrated database retrieval system