KEGG   Homo sapiens (human): 6489Help
Entry
6489              CDS       T01001                                 

Gene name
ST8SIA1, GD3S, SIAT8, SIAT8-A, SIAT8A, ST8SiaI
Definition
(RefSeq) ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 (EC:2.4.99.8)
  KO
K03371  
alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8A) [EC:2.4.99.8]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    6489 (ST8SIA1)
   00603 Glycosphingolipid biosynthesis - globo series
    6489 (ST8SIA1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    6489 (ST8SIA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.8  alpha-N-acetylneuraminate alpha-2,8-sialyltransferase
     6489 (ST8SIA1)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   6489 (ST8SIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p12.1-p11.2
AA seq 213 aa AA seqDB search
MTGSFYTHSPLTIQLTLSSHRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSR
KTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFW
KSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHA
MPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgacggggagtttttatactcattcaccattgacaattcaacttactctctcttcccac
agatgcaatctccctcctttgtcaagtgaatacactaaggatgttggatccaaaagtcag
ttagtgacagctaatcccagcataattcggcaaaggtttcagaaccttctgtggtccaga
aagacatttgtggacaacatgaaaatttataaccacagttacatctacatgcctgccttt
tctatgaagacaggaacagagccatctttgagggtttattatacactgtcagatgttggt
gccaatcaaacagtgctgtttgccaaccccaactttctgcgtagcattggaaagttctgg
aaaagtagaggaatccatgccaagcgcctgtccacaggactttttctggtgagcgcagct
ctgggtctctgtgaagaggtggccatctatggcttctggcccttctctgtgaatatgcat
gagcagcccatcagccaccactactatgacaacgtcttacccttttctggcttccatgcc
atgcccgaggaatttctccaactctggtatcttcataaaatcggtgcactgagaatgcag
ctggacccatgtgaagatacctcactccagcccacttcctag

DBGET integrated database retrieval system