KEGG   Homo sapiens (human): 3703Help
Entry
3703              CDS       T01001                                 

Gene name
STT3A, ITM1, STT3-A, TMC
Definition
STT3A, subunit of the oligosaccharyltransferase complex (catalytic) (EC:2.4.99.18)
Orthology
K07151  
dolichyl-diphosphooligosaccharide--protein glycosyltransferase [EC:2.4.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    3703 (STT3A)
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3703 (STT3A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     3703 (STT3A)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   3703 (STT3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23.3
AA seq 705 aa AA seqDB search
MTKFGFLRLSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFL
AEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLA
PLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTY
YMWIKAVKTGSICWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAY
CTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFR
SVISLVGFVLLTVGALLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSY
YFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGI
GVSQVLSTYMKNLDISRPDKKSKKQQDSTYPIKNEVASGMILVMAFFLITYTFHSTWVTS
EAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTI
LVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMV
RIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGF
DRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRGLSRT
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtttggatttttgcgattgtcctatgagaagcaggacacacttttgaagctt
ctcattctgtcaatggctgctgtattatccttctccactcgtctgtttgctgtcctgaga
tttgaaagtgttatccatgagtttgatccgtactttaattatcggactaccaggttcctg
gctgaggaggggttttataaattccataactggtttgatgaccgagcctggtaccctttg
ggacgaatcattggaggaacaatttacccaggtttaatgatcacctctgctgcaatctac
catgtactccattttttccacatcaccatcgacattcggaatgtctgtgtgttcctggcc
cctctcttctcctccttcaccaccatcgtcacgtaccaccttaccaaagagctcaaggat
gcaggggctgggcttcttgctgctgccatgattgctgtagttcctggatatatctcccga
tctgtggctggctcctatgataatgaagggattgccatcttttgcatgctactcacctac
tacatgtggatcaaggcagtaaagactggttccatctgttgggcagctaagtgtgccctt
gcttatttctacatggtctcgtcatggggaggttatgtgttcctgatcaacttaattcct
ctccacgtcctcgtgctgatgctcacaggccgtttctctcaccggatctatgtggcctac
tgtactgtttactgcctgggcactatactttctatgcagatctcctttgtgggtttccag
cctgtcctttcatcagagcacatggcagcctttggggtctttggtctctgccagatccat
gcctttgtggattacctgcgcagcaagttgaatccacaacaatttgaagttcttttccgg
agcgtcatctctctggtaggctttgtccttctcaccgtgggagctctcctcatgctgaca
ggaaaaatatctccctggacggggcgtttctactcgctgctggatccctcttatgctaag
aacaacatccccatcattgcttctgtgtctgagcatcagcccacaacctggtcctcatac
tattttgacctgcagctcctcgtcttcatgtttccagttggcctctattactgctttagc
aacctgtctgatgcccggatttttatcatcatgtatggtgtgaccagcatgtacttttca
gctgtaatggtgcgtctaatgctagtgttggcacctgttatgtgcattctctctggcatt
ggagtctcccaggtgctgtccacatacatgaagaatctggacataagtcgtccagacaag
aagagcaagaagcaacaggattccacctaccctattaagaatgaagtggcaagtgggatg
atactggtcatggctttctttctcatcacctacacctttcattcaacctgggtgaccagt
gaggcctactcttctccgtccattgtactatctgcccgtggtggggatggcagtaggatc
atatttgatgacttccgagaagcatattattggcttcgtcataatactccagaggatgcg
aaggtcatgtcctggtgggattatggctatcagattacagctatggcaaaccgaacaatt
ttagtggacaataacacatggaataatacccatatttctcgagtagggcaggcaatggcg
tccacagaggaaaaagcctatgagatcatgagggagctcgatgtcagctatgtgctggtc
atttttggaggcctcactgggtattcctctgatgatatcaacaagtttctttggatggtc
cggattggagggagcacagatacaggcaaacatatcaaggagaatgactattatactcca
actggggagttccgtgtggaccgtgaaggttctccagtgctgctcaactgcctcatgtac
aagatgtgttactatcgctttggacaggtttacacagaagccaagcgtcctccaggcttt
gaccgtgtccgaaatgctgagattgggaataaagactttgagcttgatgtcctggaggaa
gcatataccacagaacattggctggtcaggatatacaaggtaaaggacctggataatcga
ggcttgtcaaggacataa

DBGET integrated database retrieval system