KEGG   Homo sapiens (human): 201595Help
Entry
201595            CDS       T01001                                 

Gene name
STT3B, SIMP, STT3-B
Definition
STT3B, subunit of the oligosaccharyltransferase complex (catalytic) (EC:2.4.99.18)
Orthology
K07151  
dolichyl-diphosphooligosaccharide--protein glycosyltransferase [EC:2.4.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
Oligosaccharyltransferase
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3p23
AA seq 826 aa AA seqDB search
MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGAQCAHKAAGGAAPPKPAPAGLSG
GLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASHGFY
EFLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGL
TSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKS
VKTGSVFWTMCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIV
GLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLA
AGAVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHI
LVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVF
EHYLGDDMKRENPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGPNIKSIVT
MLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHAR
VMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRTLDVDYVLVI
FGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKM
SYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRET
LDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFKKGKKISKKTV
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccctcggccccggagagcaagcacaagtcgtccctcaactcgtccccgtgg
agtggcctcatggccctgggaaacagccggcacggccaccacgggcccggggcccagtgc
gcgcacaaggcggcgggcggcgcggcgccgccgaagccggccccggcggggctgtccggg
gggctgtcgcagccggctgggtggcagtcgcttctctccttcaccatcctcttcctggcc
tggcttgccggcttcagctcgcgcctcttcgccgtcatccgcttcgaaagcatcatccac
gagttcgacccgtggtttaactatagatcaacacatcatcttgcatctcatgggttctat
gaatttttaaattggtttgatgaaagagcatggtatccactaggaagaatagtaggtggt
actgtttacccagggttgatgataaccgctggccttattcattggattttaaatacattg
aacataactgttcacataagagacgtatgtgtgttccttgcaccaacttttagcggcctt
acatctatatctactttcctgcttacaagagaactttggaaccaaggagcaggactttta
gctgcttgttttattgctattgtaccaggctacatatctcggtcagtagctggatccttt
gataatgaaggcattgctatttttgcacttcagttcacatactatttatgggtaaaatct
gtaaaaactgggtcagttttttggacaatgtgctgctgcttatcctatttctatatggtc
tctgcttggggtggttatgtatttatcatcaatcttattccactgcatgtatttgtgttg
ttactgatgcagagatacagcaaaagagtctacatagcatatagcactttctacattgtg
ggtttaatattatcaatgcagataccttttgtgggattccagccaatcagaacaagtgaa
cacatggcagctgcaggtgtctttgcattgctgcaagcttatgctttcttgcagtatctg
agagaccgattaacaaaacaagagttccagacccttttctttttgggtgtatcactagct
gcaggtgctgtgttccttagtgtcatctatttgacttatacaggttacattgcaccatgg
agtggcaggttttattcattgtgggatactgggtatgcaaaaatacacattccaattatt
gcatcagtgtctgagcatcaacctacgacttgggtgtctttcttctttgatctacatatt
cttgtatgtaccttcccagcaggcctttggttctgcatcaaaaatatcaacgatgaaaga
gtatttgttgctctatatgcaatcagtgctgtctactttgctggagtgatggtgcgactg
atgttgactttgactccagtcgtgtgtatgctgtctgcaattgccttttcaaatgttttt
gagcactatttgggggatgacatgaaaagggaaaatccacctgtggaggacagcagtgat
gaggatgacaaaagaaaccaaggaaatttgtatgataaggcaggtaaagtgaggaaacat
gcaactgaacaggaaaaaactgaagagggattaggccctaatataaaaagcattgtcacc
atgttgatgctgatgctattgatgatgtttgctgtccactgtacctgggtcacaagcaat
gcctactctagtccaagtgtagtcctggcctcatacaatcatgatggcaccaggaatatc
ttagatgattttagagaagcttacttttggctaaggcaaaatacagatgaacatgcacga
gtaatgtcttggtgggattatggctatcagatagctggaatggctaatagaactacgttg
gtggataataacacctggaataacagccacatagcactggtgggaaaagctatgtcttct
aatgaaacagcagcctataaaatcatgaggactctagatgtagattatgttttggttatt
tttggaggggttattggctattctggtgatgatatcaacaaatttctctggatggttagg
atagctgaaggagaacatcccaaagacattcgggaaagtgactattttaccccacaggga
gaattccgtgtagacaaagcaggatcccctactttgttgaattgccttatgtataaaatg
tcatactacagatttggagaaatgcagctggattttcgtacacccccaggttttgaccga
acacgtaatgctgagattggaaataaggacattaaattcaaacatttggaagaagccttt
acatcagaacactggcttgttaggatatataaagtaaaagcacctgataacagggagaca
ttagatcacaaacctcgagtcaccaacattttcccaaaacagaagtatttgtcaaagaag
actaccaaaaggaagcgtggctacattaaaaataagctggtttttaagaaaggcaagaaa
atatctaagaagactgtttaa

DBGET integrated database retrieval system