KEGG   Homo sapiens (human): 201595Help
Entry
201595            CDS       T01001                                 

Gene name
STT3B, CDG1X, SIMP, STT3-B
Definition
STT3B, subunit of the oligosaccharyltransferase complex (catalytic) (EC:2.4.99.18)
Orthology
K07151  
dolichyl-diphosphooligosaccharide--protein glycosyltransferase [EC:2.4.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    201595 (STT3B)
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    201595 (STT3B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     201595 (STT3B)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   201595 (STT3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3p23
AA seq 826 aa AA seqDB search
MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGAQCAHKAAGGAAPPKPAPAGLSG
GLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASHGFY
EFLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGL
TSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKS
VKTGSVFWTMCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIV
GLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLA
AGAVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHI
LVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVF
EHYLGDDMKRENPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGPNIKSIVT
MLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHAR
VMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRTLDVDYVLVI
FGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKM
SYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRET
LDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFKKGKKISKKTV
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccctcggccccggagagcaagcacaagtcgtccctcaactcgtccccgtgg
agtggcctcatggccctgggaaacagccggcacggccaccacgggcccggggcccagtgc
gcgcacaaggcggcgggcggcgcggcgccgccgaagccggccccggcggggctgtccggg
gggctgtcgcagccggctgggtggcagtcgcttctctccttcaccatcctcttcctggcc
tggcttgccggcttcagctcgcgcctcttcgccgtcatccgcttcgaaagcatcatccac
gagttcgacccgtggtttaactatagatcaacacatcatcttgcatctcatgggttctat
gaatttttaaattggtttgatgaaagagcatggtatccactaggaagaatagtaggtggt
actgtttacccagggttgatgataaccgctggccttattcattggattttaaatacattg
aacataactgttcacataagagacgtatgtgtgttccttgcaccaacttttagcggcctt
acatctatatctactttcctgcttacaagagaactttggaaccaaggagcaggactttta
gctgcttgttttattgctattgtaccaggctacatatctcggtcagtagctggatccttt
gataatgaaggcattgctatttttgcacttcagttcacatactatttatgggtaaaatct
gtaaaaactgggtcagttttttggacaatgtgctgctgcttatcctatttctatatggtc
tctgcttggggtggttatgtatttatcatcaatcttattccactgcatgtatttgtgttg
ttactgatgcagagatacagcaaaagagtctacatagcatatagcactttctacattgtg
ggtttaatattatcaatgcagataccttttgtgggattccagccaatcagaacaagtgaa
cacatggcagctgcaggtgtctttgcattgctgcaagcttatgctttcttgcagtatctg
agagaccgattaacaaaacaagagttccagacccttttctttttgggtgtatcactagct
gcaggtgctgtgttccttagtgtcatctatttgacttatacaggttacattgcaccatgg
agtggcaggttttattcattgtgggatactgggtatgcaaaaatacacattccaattatt
gcatcagtgtctgagcatcaacctacgacttgggtgtctttcttctttgatctacatatt
cttgtatgtaccttcccagcaggcctttggttctgcatcaaaaatatcaacgatgaaaga
gtatttgttgctctatatgcaatcagtgctgtctactttgctggagtgatggtgcgactg
atgttgactttgactccagtcgtgtgtatgctgtctgcaattgccttttcaaatgttttt
gagcactatttgggggatgacatgaaaagggaaaatccacctgtggaggacagcagtgat
gaggatgacaaaagaaaccaaggaaatttgtatgataaggcaggtaaagtgaggaaacat
gcaactgaacaggaaaaaactgaagagggattaggccctaatataaaaagcattgtcacc
atgttgatgctgatgctattgatgatgtttgctgtccactgtacctgggtcacaagcaat
gcctactctagtccaagtgtagtcctggcctcatacaatcatgatggcaccaggaatatc
ttagatgattttagagaagcttacttttggctaaggcaaaatacagatgaacatgcacga
gtaatgtcttggtgggattatggctatcagatagctggaatggctaatagaactacgttg
gtggataataacacctggaataacagccacatagcactggtgggaaaagctatgtcttct
aatgaaacagcagcctataaaatcatgaggactctagatgtagattatgttttggttatt
tttggaggggttattggctattctggtgatgatatcaacaaatttctctggatggttagg
atagctgaaggagaacatcccaaagacattcgggaaagtgactattttaccccacaggga
gaattccgtgtagacaaagcaggatcccctactttgttgaattgccttatgtataaaatg
tcatactacagatttggagaaatgcagctggattttcgtacacccccaggttttgaccga
acacgtaatgctgagattggaaataaggacattaaattcaaacatttggaagaagccttt
acatcagaacactggcttgttaggatatataaagtaaaagcacctgataacagggagaca
ttagatcacaaacctcgagtcaccaacattttcccaaaacagaagtatttgtcaaagaag
actaccaaaaggaagcgtggctacattaaaaataagctggtttttaagaaaggcaagaaa
atatctaagaagactgtttaa

DBGET integrated database retrieval system