KEGG   Homo sapiens (human): 7357Help
Entry
7357              CDS       T01001                                 

Gene name
UGCG, GCS, GLCT1
Definition
UDP-glucose ceramide glucosyltransferase (EC:2.4.1.80)
Orthology
K00720  
ceramide glucosyltransferase [EC:2.4.1.80]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Lactosylceramide biosynthesis
Drug target
Miglustat: 
Eliglustat: 
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:hsa00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
9q31
AA seq 394 aa AA seqDB search
MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLK
GVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVG
INPKINNLMPGYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGF
AATLEQVYFGTSHPRYYISANVTGFKCVTGMSCLMRKDVLDQAGGLIAFAQYIAEDYFMA
KAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLRINMLPATIICEPISECFVAS
LIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYAVAWFIRESMT
IYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctggacctggccttggagggaatggccgtcttcgggttcgtcctcttcttg
gtgctgtggctgatgcatttcatggctatcatctacacccgattacacctcaacaagaag
gcaactgacaaacagccttatagcaagctcccaggtgtctctcttctgaaaccactgaaa
ggggtagatcctaacttaatcaacaacctggaaacattctttgaattggattatcccaaa
tatgaagtgctcctttgtgtacaagatcatgatgatccagccattgatgtatgtaagaag
cttcttggaaaatatccaaatgttgatgctagattgtttataggtggtaaaaaagttggc
attaatcctaaaattaataatttaatgccaggatatgaagttgcaaagtatgatcttata
tggatttgtgatagtggaataagagtaattccagatacgcttactgacatggtgaatcaa
atgacagaaaaagtaggcttggttcacgggctgccttacgtagcagacagacagggcttt
gctgccaccttagagcaggtatattttggaacttcacatccaagatactatatctctgcc
aatgtaactggtttcaaatgtgtgacaggaatgtcttgtttaatgagaaaagatgtgttg
gatcaagcaggaggacttatagcttttgctcagtacattgccgaagattactttatggcc
aaagcgatagctgaccgaggttggaggtttgcaatgtccactcaagttgcaatgcaaaac
tctggctcatattcaatttctcagtttcaatccagaatgatcaggtggaccaaactacga
attaacatgcttcctgctacaataatttgtgagccaatttcagaatgctttgttgccagt
ttaattattggatgggcagcccaccatgtgttcagatgggatattatggtatttttcatg
tgtcattgcctggcatggtttatatttgactacattcaactcaggggtgtccagggtggc
acactgtgtttttcaaaacttgattatgcagtcgcctggttcatccgcgaatccatgaca
atatacatttttttgtctgcattatgggacccaactataagctggagaactggtcgctac
agattacgctgtgggggtacagcagaggaaatcctagatgtataa

DBGET integrated database retrieval system