KEGG   Homo sapiens (human): 7368Help
Entry
7368              CDS       T01001                                 

Gene name
UGT8, CGT, UGT4
Definition
UDP glycosyltransferase 8 (EC:2.4.1.45)
Orthology
K04628  
2-hydroxyacylsphingosine 1-beta-galactosyltransferase [EC:2.4.1.45]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Cerebroside and sulfatide biosynthesis
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:hsa00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q26
AA seq 541 aa AA seqDB search
MKSYTPYFILLWSAVGIAKAAKIIIVPPIMFESHMYIFKTLASALHERGHHTVFLLSEGR
DIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGN
HALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEF
NSLLTDRMNLLQRMKNTGVYLISRLGVSFLVLPKYERIMQKYNLLPEKSMYDLVHGSSLW
MLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVNGANEHGFVLVSFGAGVKYL
SEDIANKLAGALGRLPQKVIWRFSGPKPKNLGNNTKLIEWLPQNDLLGHSKIKAFLSHGG
LNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWKTVTEKELYEALVKVINNP
SYRQRAQKLSEIHKDQPGHPVNRTIYWIDYIIRHNGAHHLRAAVHQISFCQYFLLDIAFV
LLLGAALLYFLLSWVTKFIYRKIKSLWSRNKHSTVNGHYHNGILNGKYKRNGHIKHEKKV
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcttacactccatatttcattctcctgtggagtgctgttgggatagcgaaggct
gccaaaatcatcatcgtgccgccaattatgtttgaaagccatatgtacattttcaagacg
ctagcctcagccttgcacgagagaggccaccatacagtgttcctcctctctgaaggcaga
gacatcgccccatctaatcattacagcctccagcgctacccagggatctttaacagtacc
acctcagatgctttcctacagtccaagatgcggaatattttctctgggagattgacagca
atcgaactgtttgacatactggatcactatactaagaactgtgacctgatggttggcaac
catgccctgatccagggtctgaagaaagaaaaatttgacctgctgctggtggaccctaat
gatatgtgtggatttgtgatagctcatcttttaggggttaaatatgctgtattttcaact
ggcctttggtatcctgctgaagtgggtgctcctgctccattagcatacgtcccagagttt
aactcactcctcacagaccgcatgaacttgctgcaaaggatgaaaaataccggtgtttac
ctcatttccagattaggggtcagctttctggttcttcccaaatatgaaaggataatgcag
aagtacaacctgctgccggagaagtccatgtatgatttggttcatgggtccagcctgtgg
atgctgtgtactgacgtagcactggaattcccaagacccactctgcctaatgttgtttat
gtaggaggaatcctaaccaaaccagccagcccactaccagaagatctccaaagatgggta
aatggtgctaatgaacatggctttgtcttggtgtcttttggagctggtgtcaagtatctg
tcagaagacattgctaacaaactggcaggagctctggggagattgcctcaaaaagtgatt
tggaggttttctggacccaaaccaaagaatctaggaaacaacactaaactcatagaatgg
ttaccacaaaatgacctgcttgggcattcaaagattaaagccttcctgagccatggtggt
ttgaacagtatttttgaaactatgtatcatggtgtgcctgtagtgggaattccactcttt
ggagaccattatgatactatgaccagagtacaggcaaaaggcatggggatattgctagaa
tggaagacagttactgaaaaagagctctatgaagcactagtgaaggttatcaataatccc
agctaccgtcagagggctcagaagctttcggaaattcacaaggatcaacctggtcaccct
gtcaatcgaactatctattggatagattatattattcgtcacaatggagcccatcaccta
cgtgccgctgtccatcagatctccttttgtcagtattttttactggatattgcctttgtg
cttttgcttggtgctgccttgttatactttctcttgtcttgggtgacaaaatttatctac
agaaaaatcaaaagtctgtggtctagaaataagcatagcacagttaatggacattaccac
aatggaatcctcaatggcaagtacaaaagaaatggccatattaaacatgaaaagaaagtg
aaatga

DBGET integrated database retrieval system