KEGG   Homo sapiens (human): 7368Help
Entry
7368              CDS       T01001                                 

Gene name
UGT8, CGT, UGT4
Definition
(RefSeq) UDP glycosyltransferase 8
  KO
K04628  ceramide galactosyltransferase [EC:2.4.1.47]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
Module
hsa_M00067  Sulfoglycolipids biosynthesis, ceramide/1-alkyl-2-acylglycerol => sulfatide/seminolipid
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00565 Ether lipid metabolism
    7368 (UGT8)
   00600 Sphingolipid metabolism
    7368 (UGT8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.47  N-acylsphingosine galactosyltransferase
     7368 (UGT8)
Glycosyltransferases [BR:hsa01003]
 Glycolipid biosynthesis
  Glycosphingolipid
   7368 (UGT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Imm39 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 7368
NCBI-ProteinID: NP_001121646
OMIM: 601291
HGNC: 12555
Ensembl: ENSG00000174607
Vega: OTTHUMG00000132915
Pharos: Q16880(Tbio)
UniProt: Q16880
Position
4q26
AA seq 541 aa AA seqDB search
MKSYTPYFILLWSAVGIAKAAKIIIVPPIMFESHMYIFKTLASALHERGHHTVFLLSEGR
DIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGN
HALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEF
NSLLTDRMNLLQRMKNTGVYLISRLGVSFLVLPKYERIMQKYNLLPEKSMYDLVHGSSLW
MLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVNGANEHGFVLVSFGAGVKYL
SEDIANKLAGALGRLPQKVIWRFSGPKPKNLGNNTKLIEWLPQNDLLGHSKIKAFLSHGG
LNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWKTVTEKELYEALVKVINNP
SYRQRAQKLSEIHKDQPGHPVNRTIYWIDYIIRHNGAHHLRAAVHQISFCQYFLLDIAFV
LLLGAALLYFLLSWVTKFIYRKIKSLWSRNKHSTVNGHYHNGILNGKYKRNGHIKHEKKV
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcttacactccatatttcattctcctgtggagtgctgttgggatagcgaaggct
gccaaaatcatcatcgtgccgccaattatgtttgaaagccatatgtacattttcaagacg
ctagcctcagccttgcacgagagaggccaccatacagtgttcctcctctctgaaggcaga
gacatcgccccatctaatcattacagcctccagcgctacccagggatctttaacagtacc
acctcagatgctttcctacagtccaagatgcggaatattttctctgggagattgacagca
atcgaactgtttgacatactggatcactatactaagaactgtgacctgatggttggcaac
catgccctgatccagggtctgaagaaagaaaaatttgacctgctgctggtggaccctaat
gatatgtgtggatttgtgatagctcatcttttaggggttaaatatgctgtattttcaact
ggcctttggtatcctgctgaagtgggtgctcctgctccattagcatacgtcccagagttt
aactcactcctcacagaccgcatgaacttgctgcaaaggatgaaaaataccggtgtttac
ctcatttccagattaggggtcagctttctggttcttcccaaatatgaaaggataatgcag
aagtacaacctgctgccggagaagtccatgtatgatttggttcatgggtccagcctgtgg
atgctgtgtactgacgtagcactggaattcccaagacccactctgcctaatgttgtttat
gtaggaggaatcctaaccaaaccagccagcccactaccagaagatctccaaagatgggta
aatggtgctaatgaacatggctttgtcttggtgtcttttggagctggtgtcaagtatctg
tcagaagacattgctaacaaactggcaggagctctggggagattgcctcaaaaagtgatt
tggaggttttctggacccaaaccaaagaatctaggaaacaacactaaactcatagaatgg
ttaccacaaaatgacctgcttgggcattcaaagattaaagccttcctgagccatggtggt
ttgaacagtatttttgaaactatgtatcatggtgtgcctgtagtgggaattccactcttt
ggagaccattatgatactatgaccagagtacaggcaaaaggcatggggatattgctagaa
tggaagacagttactgaaaaagagctctatgaagcactagtgaaggttatcaataatccc
agctaccgtcagagggctcagaagctttcggaaattcacaaggatcaacctggtcaccct
gtcaatcgaactatctattggatagattatattattcgtcacaatggagcccatcaccta
cgtgccgctgtccatcagatctccttttgtcagtattttttactggatattgcctttgtg
cttttgcttggtgctgccttgttatactttctcttgtcttgggtgacaaaatttatctac
agaaaaatcaaaagtctgtggtctagaaataagcatagcacagttaatggacattaccac
aatggaatcctcaatggcaagtacaaaagaaatggccatattaaacatgaaaagaaagtg
aaatga

DBGET integrated database retrieval system