KEGG   Homo sapiens (human): 1Help
Entry
1                 CDS       T01001                                 

Gene name
A1BG, A1B, ABG, GAB, HYST2477
Definition
alpha-1-B glycoprotein
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.4
AA seq 495 aa AA seqDB search
MSMLVVFLLLWGVTWGPVTEAAIFYETQPSLWAESESLLKPLANVTLTCQAHLETPDFQL
FKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPW
LSMAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNY
SCSYRTDGEGALSEPSATVTIEELAAPPPPVLMHHGESSQVLHPGNKVTLTCVAPLSGVD
FQLRRGEKELLVPRSSTSPDRIFFHLNAVALGDGGHYTCRYRLHDNQNGWSGDSAPVELI
LSDETLPAPEFSPEPESGRALRLRCLAPLEGARFALVREDRGGRRVHRFQSPAGTEALFE
LHNISVADSANYSCVYVDLKPPFGGSAPSERLELHVDGPPPRPQLRATWSGAVLAGRDAV
LRCEGPIPDVTFELLREGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTF
ESELSDPVELLVAES
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgctcgtggtctttctcttgctgtggggtgtcacctggggcccagtgacagaa
gcagccatattttatgagacgcagcccagcctgtgggcagagtccgaatcactgctgaaa
cccttggccaatgtgacgctgacgtgccaggcccacctggagactccagacttccagctg
ttcaagaatggggtggcccaggagcctgtgcaccttgactcacctgccatcaagcaccag
ttcctgctgacgggtgacacccagggccgctaccgctgccgctcgggcttgtccacagga
tggacccagctgagcaagctcctggagctgacagggccaaagtccttgcctgctccctgg
ctctcgatggcgccagtgtcctggatcacccccggcctgaaaacaacagcagtgtgccga
ggtgtgctgcggggtgtgacttttctgctgaggcgggagggcgaccatgagtttctggag
gtgcctgaggcccaggaggatgtggaggccacctttccagtccatcagcctggcaactac
agctgcagctaccggaccgatggggaaggcgccctctctgagcccagcgctactgtgacc
attgaggagctcgctgcaccaccaccgcctgtgctgatgcaccatggagagtcctcccag
gtcctgcaccctggcaacaaggtgaccctcacctgcgtggctcccctgagtggagtggac
ttccagctacggcgcggggagaaagagctgctggtacccaggagcagcaccagcccagat
cgcatcttctttcacctgaacgcggtggccctgggggatggaggtcactacacctgccgc
taccggctgcatgacaaccaaaacggctggtccggggacagcgcgccggtcgagctgatt
ctgagcgatgagacgctgcccgcgccggagttctccccggagccggagtccggcagggcc
ttgcggctgcggtgcctggcgcccctggagggcgcgcgcttcgccctggtgcgcgaggac
aggggcgggcgccgcgtgcaccgtttccagagccccgctgggaccgaggcgctcttcgag
ctgcacaacatttccgtggctgactccgccaactacagctgcgtctacgtggacctgaag
ccgcctttcgggggctccgcgcccagcgagcgcttggagctgcacgtggacggaccccct
cccaggcctcagctccgggcgacgtggagtggggcggtcctggcgggccgagatgccgtc
ctgcgctgcgagggacccatccccgacgtcaccttcgagctgctgcgcgagggcgagacg
aaggccgtgaagacggtccgcacccccggggccgcggcgaacctcgagctgatcttcgtg
gggccccagcacgccggcaactacaggtgccgctaccgctcctgggtgccccacaccttc
gaatcggagctcagcgaccctgtggagctcctggtggcagaaagctga

DBGET integrated database retrieval system