KEGG   Homo sapiens (human): 1000Help
Entry
1000              CDS       T01001                                 

Gene name
CDH2, CD325, CDHN, CDw325, NCAD
Definition
(RefSeq) cadherin 2
  KO
K06736  
cadherin 2, type 1, N-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1000 (CDH2)
 Human Diseases
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    1000 (CDH2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    1000 (CDH2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     1000 (CDH2)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     1000 (CDH2)
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type I classic cadherins
    CDH2; cadherin 2, type 1, N-cadherin [KO:K06736]
     1000 (CDH2)
    CDH4; cadherin 4, type 1, R-cadherin [KO:K06797]
     1000 (CDH2)
Cellular antigens [BR:hsa04090]
 Proteins
  1000 (CDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P19022(Tbio)
UniProt: 
Position
18q12.1
AA seq 906 aa AA seqDB search
MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKF
SNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVK
LSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQEL
VRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAV
DINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNAL
NGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTY
GLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVY
RISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQS
TATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDP
ANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDIND
NAPQVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGD
FAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGL
GTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGE
EDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGL
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADM
YGGGDD
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgtgccggatagcgggagcgctgcggaccctgctgccgctgctggcggccctgcttcag
gcgtctgtagaggcttctggtgaaatcgcattatgcaagactggatttcctgaagatgtt
tacagtgcagtcttatcgaaggatgtgcatgaaggacagcctcttctcaatgtgaagttt
agcaactgcaatggaaaaagaaaagtacaatatgagagcagtgagcctgcagattttaag
gtggatgaagatggcatggtgtatgccgtgagaagctttccactctcttctgagcatgcc
aagttcctgatatatgcccaagacaaagagacccaggaaaagtggcaagtggcagtaaaa
ttgagcctgaagccaaccttaactgaggagtcagtgaaggagtcagcagaagttgaagaa
atagtgttcccaagacaattcagtaagcacagtggccacctacaaaggcagaagagagac
tgggtcatccctccaatcaacttgccagaaaactccaggggaccttttcctcaagagctt
gtcaggatcaggtctgatagagataaaaacctttcactgcggtacagtgtaactgggcca
ggagctgaccagcctccaactggtatcttcattatcaaccccatctcgggtcagctgtcg
gtgacaaagcccctggatcgcgagcagatagcccggtttcatttgagggcacatgcagta
gatattaatggaaatcaagtggagaaccccattgacattgtcatcaatgttattgacatg
aatgacaacagacctgagttcttacaccaggtttggaatgggacagttcctgagggatca
aagcctggaacatatgtgatgaccgtaacagcaattgatgctgacgatcccaatgccctc
aatgggatgttgaggtacagaatcgtgtctcaggctccaagcaccccttcacccaacatg
tttacaatcaacaatgagactggtgacatcatcacagtggcagctggacttgatcgagaa
aaagtgcaacagtatacgttaataattcaagctacagacatggaaggcaatcccacatat
ggcctttcaaacacagccacggccgtcatcacagtgacagatgtcaatgacaatcctcca
gagtttactgccatgacgttttatggtgaagttcctgagaacagggtagacatcatagta
gctaatctaactgtgaccgataaggatcaaccccatacaccagcctggaacgcagtgtac
agaatcagtggcggagatcctactggacggttcgccatccagaccgacccaaacagcaac
gacgggttagtcaccgtggtcaaaccaatcgactttgaaacaaataggatgtttgtcctt
actgttgctgcagaaaatcaagtgccattagccaagggaattcagcacccgcctcagtca
actgcaaccgtgtctgttacagttattgacgtaaatgaaaacccttattttgcccccaat
cctaagatcattcgccaagaagaagggcttcatgccggtaccatgttgacaacattcact
gctcaggacccagatcgatatatgcagcaaaatattagatacactaaattatctgatcct
gccaattggctaaaaatagatcctgtgaatggacaaataactacaattgctgttttggac
cgagaatcaccaaatgtgaaaaacaatatatataatgctactttccttgcttctgacaat
ggaattcctcctatgagtggaacaggaacgctgcagatctatttacttgatattaatgac
aatgcccctcaagtgttacctcaagaggcagagacttgcgaaactccagaccccaattca
attaatattacagcacttgattatgacattgatccaaatgctggaccatttgcttttgat
cttcctttatctccagtgactattaagagaaattggaccatcactcggcttaatggtgat
tttgctcagcttaatttaaagataaaatttcttgaagctggtatctatgaagttcccatc
ataatcacagattcgggtaatcctcccaaatcaaatatttccatcctgcgcgtgaaggtt
tgccagtgtgactccaacggggactgcacagatgtggacaggattgtgggtgcggggctt
ggcaccggtgccatcattgccatcctgctctgcatcatcatcctgcttatccttgtgctg
atgtttgtggtatggatgaaacgccgggataaagaacgccaggccaaacaacttttaatt
gatccagaagatgatgtaagagataatattttaaaatatgatgaagaaggtggaggagaa
gaagaccaggactatgacttgagccagctgcagcagcctgacactgtggagcctgatgcc
atcaagcctgtgggaatccgacgaatggatgaaagacccatccacgccgagccccagtat
ccggtccgatctgcagccccacaccctggagacattggggacttcattaatgagggcctt
aaagcggctgacaatgaccccacagctccaccatatgactccctgttagtgtttgactat
gaaggcagtggctccactgctgggtccttgagctcccttaattcctcaagtagtggtggt
gagcaggactatgattacctgaacgactgggggccacggttcaagaaacttgctgacatg
tatggtggaggtgatgactga

DBGET integrated database retrieval system