KEGG   Homo sapiens (human): 10002Help
Entry
10002             CDS       T01001                                 

Gene name
NR2E3, ESCS, PNR, RNR, RP37, rd7
Definition
nuclear receptor subfamily 2, group E, member 3
Orthology
K08546  
nuclear receptor subfamily 2 group E member 3
Organism
hsa  Homo sapiens (human)
Disease
H00527  
Retinitis pigmentosa (RP)
H00805  
Vitreoretinal degeneration
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
15q23
AA seq 410 aa AA seqDB search
METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVCGDSSSGKHYG
IYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQN
ERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITA
ETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPV
FSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMET
RVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAH
HPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggagaccagaccaacagctctgatgagctccacagtggctgcagctgcgcctgcagct
ggggctgcctccaggaaggagtctccaggcagatggggcctgggggaggatcccacaggc
gtgagcccctcgctccagtgccgcgtgtgcggagacagcagcagcgggaagcactatggc
atctatgcctgcaacggctgcagcggcttcttcaagaggagcgtacggcggaggctcatc
tacaggtgccaggtgggggcagggatgtgccccgtggacaaggcccaccgcaaccagtgc
caggcctgccggctgaagaagtgcctgcaggcggggatgaaccaggacgccgtgcagaac
gagcgccagccgcgaagcacagcccaggtccacctggacagcatggagtccaacactgag
tcccggccggagtccctggtggctcccccggccccggcagggcgcagcccacggggcccc
acacccatgtctgcagccagagccctgggccaccacttcatggccagccttataacagct
gaaacctgtgctaagctggagccagaggatgctgatgagaatattgatgtcaccagcaat
gaccctgagttcccctcctctccatactcctcttcctccccctgcggcctggacagcatc
catgagacctcggctcgcctactcttcatggccgtcaagtgggccaagaacctgcctgtg
ttctccagcctgcccttccgggatcaggtgatcctgctggaagaggcgtggagtgaactc
tttctcctcggggccatccagtggtctctgcctctggacagctgtcctctgctggcaccg
cccgaggcctctgctgccggtggtgcccagggccggctcacgctggccagcatggagacg
cgtgtcctgcaggaaactatctctcggttccgggcattggcggtggaccccacggagttt
gcctgcatgaaggccttggtcctcttcaagccagagacgcggggcctgaaggatcctgag
cacgtagaggccttgcaggaccagtcccaagtgatgctgagccagcacagcaaggcccac
caccccagccagcccgtgaggtttgggaaattgctcctgctcctcccgtctttgaggttt
atcactgcggaacgcatcgagctcctctttttccgcaagaccatagggaatactccaatg
gagaagctcctttgtgatatgttcaaaaactag

DBGET integrated database retrieval system